Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3030
Gene name
LocationContig_222:5713..6388
Strand-
Gene length (bp)675
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01868 RNase_P-MRP_p29 Ribonuclease P/MRP, subunit p29 1.0E-26 123 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CR08|RPP29_MOUSE Ribonuclease P protein subunit p29 OS=Mus musculus GN=Pop4 PE=2 SV=1 66 217 2.0E-26
sp|Q5M882|RPP29_RAT Ribonuclease P protein subunit p29 OS=Rattus norvegicus GN=Pop4 PE=2 SV=1 72 217 9.0E-26
sp|Q5R7B0|RPP29_PONAB Ribonuclease P protein subunit p29 OS=Pongo abelii GN=POP4 PE=2 SV=1 72 217 1.0E-25
sp|Q2KIB9|RPP29_BOVIN Ribonuclease P protein subunit p29 OS=Bos taurus GN=POP4 PE=2 SV=1 72 217 3.0E-25
sp|O95707|RPP29_HUMAN Ribonuclease P protein subunit p29 OS=Homo sapiens GN=POP4 PE=1 SV=2 72 217 7.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CR08|RPP29_MOUSE Ribonuclease P protein subunit p29 OS=Mus musculus GN=Pop4 PE=2 SV=1 66 217 2.0E-26
sp|Q5M882|RPP29_RAT Ribonuclease P protein subunit p29 OS=Rattus norvegicus GN=Pop4 PE=2 SV=1 72 217 9.0E-26
sp|Q5R7B0|RPP29_PONAB Ribonuclease P protein subunit p29 OS=Pongo abelii GN=POP4 PE=2 SV=1 72 217 1.0E-25
sp|Q2KIB9|RPP29_BOVIN Ribonuclease P protein subunit p29 OS=Bos taurus GN=POP4 PE=2 SV=1 72 217 3.0E-25
sp|O95707|RPP29_HUMAN Ribonuclease P protein subunit p29 OS=Homo sapiens GN=POP4 PE=1 SV=2 72 217 7.0E-25
sp|Q9P7W9|RNP1_SCHPO Probable ribonuclease P protein subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1703.01c PE=3 SV=2 7 217 1.0E-20
sp|P38336|POP4_YEAST RNases MRP/P 32.9 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP4 PE=1 SV=1 91 217 2.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0001682 tRNA 5'-leader removal Yes
GO:0030677 ribonuclease P complex Yes
GO:0006396 RNA processing Yes
GO:0006399 tRNA metabolic process No
GO:0005575 cellular_component No
GO:0046483 heterocycle metabolic process No
GO:0009987 cellular process No
GO:0008033 tRNA processing No
GO:0034470 ncRNA processing No
GO:0034660 ncRNA metabolic process No
GO:1902555 endoribonuclease complex No
GO:0032991 protein-containing complex No
GO:0099116 tRNA 5'-end processing No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0000966 RNA 5'-end processing No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:1990904 ribonucleoprotein complex No
GO:1902494 catalytic complex No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5587
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3030 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1046
Ophiocordyceps camponoti-floridani Ophcf2|05556
Ophiocordyceps camponoti-rufipedis Ophun1|4403
Ophiocordyceps kimflemingae Ophio5|4229
Ophiocordyceps subramaniannii Hirsu2|7499

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3030
MADERLPHSAATQQLLLRAHSPTTAKQIYSDKIDHRPLLLKPSSPPRHILKSRAARRKARQAEKTKAKSKTLSSR
QRRRLGLDEIPRDGHRYHLYEPLHQLWLGYAREILANDLFTGGPGAAAKLSSAELHGALAQVVRSRCPDRVGIRG
IVVRDRKFVMEIVTPTRGLKIVPKEGTTFRFEVAPLDQKPGDNPFVFEVLGDQLMLRSADRANKKFKMHFLPNL*
Coding >OphauG2|3030
ATGGCGGACGAGCGACTGCCGCACTCTGCTGCCACCCAACAGCTTCTTCTAAGAGCGCATTCGCCCACTACAGCG
AAACAGATCTATAGCGACAAGATTGACCATCGTCCTCTCCTGCTCAAGCCATCGTCTCCACCGCGCCATATCCTG
AAATCGCGTGCCGCCCGACGCAAGGCCCGGCAAGCAGAAAAGACAAAGGCCAAGAGCAAGACGCTGTCCTCTCGC
CAGCGGCGGCGCCTGGGCCTTGATGAGATTCCCAGAGACGGCCATAGATACCATCTTTACGAGCCACTGCATCAA
CTGTGGCTTGGCTATGCGCGCGAGATCTTGGCAAACGACCTCTTCACTGGCGGCCCTGGCGCTGCGGCAAAGCTT
TCTAGCGCCGAGCTGCATGGAGCACTTGCTCAGGTTGTCCGGAGTCGCTGTCCGGACCGCGTGGGCATTAGAGGC
ATCGTAGTTCGCGATCGCAAGTTTGTCATGGAAATCGTGACGCCAACCAGAGGACTCAAGATTGTCCCCAAGGAG
GGCACGACATTCCGCTTCGAGGTGGCGCCATTGGACCAGAAGCCAGGCGACAACCCCTTTGTCTTCGAGGTGCTT
GGAGATCAGCTGATGCTGCGTTCTGCGGATCGCGCCAACAAAAAATTCAAGATGCACTTTCTCCCCAATCTATAG
Transcript >OphauG2|3030
ATGGCGGACGAGCGACTGCCGCACTCTGCTGCCACCCAACAGCTTCTTCTAAGAGCGCATTCGCCCACTACAGCG
AAACAGATCTATAGCGACAAGATTGACCATCGTCCTCTCCTGCTCAAGCCATCGTCTCCACCGCGCCATATCCTG
AAATCGCGTGCCGCCCGACGCAAGGCCCGGCAAGCAGAAAAGACAAAGGCCAAGAGCAAGACGCTGTCCTCTCGC
CAGCGGCGGCGCCTGGGCCTTGATGAGATTCCCAGAGACGGCCATAGATACCATCTTTACGAGCCACTGCATCAA
CTGTGGCTTGGCTATGCGCGCGAGATCTTGGCAAACGACCTCTTCACTGGCGGCCCTGGCGCTGCGGCAAAGCTT
TCTAGCGCCGAGCTGCATGGAGCACTTGCTCAGGTTGTCCGGAGTCGCTGTCCGGACCGCGTGGGCATTAGAGGC
ATCGTAGTTCGCGATCGCAAGTTTGTCATGGAAATCGTGACGCCAACCAGAGGACTCAAGATTGTCCCCAAGGAG
GGCACGACATTCCGCTTCGAGGTGGCGCCATTGGACCAGAAGCCAGGCGACAACCCCTTTGTCTTCGAGGTGCTT
GGAGATCAGCTGATGCTGCGTTCTGCGGATCGCGCCAACAAAAAATTCAAGATGCACTTTCTCCCCAATCTATAG
Gene >OphauG2|3030
ATGGCGGACGAGCGACTGCCGCACTCTGCTGCCACCCAACAGCTTCTTCTAAGAGCGCATTCGCCCACTACAGCG
AAACAGATCTATAGCGACAAGATTGACCATCGTCCTCTCCTGCTCAAGCCATCGTCTCCACCGCGCCATATCCTG
AAATCGCGTGCCGCCCGACGCAAGGCCCGGCAAGCAGAAAAGACAAAGGCCAAGAGCAAGACGCTGTCCTCTCGC
CAGCGGCGGCGCCTGGGCCTTGATGAGATTCCCAGAGACGGCCATAGATACCATCTTTACGAGCCACTGCATCAA
CTGTGGCTTGGCTATGCGCGCGAGATCTTGGCAAACGACCTCTTCACTGGCGGCCCTGGCGCTGCGGCAAAGCTT
TCTAGCGCCGAGCTGCATGGAGCACTTGCTCAGGTTGTCCGGAGTCGCTGTCCGGACCGCGTGGGCATTAGAGGC
ATCGTAGTTCGCGATCGCAAGTTTGTCATGGAAATCGTGACGCCAACCAGAGGACTCAAGATTGTCCCCAAGGAG
GGCACGACATTCCGCTTCGAGGTGGCGCCATTGGACCAGAAGCCAGGCGACAACCCCTTTGTCTTCGAGGTGCTT
GGAGATCAGCTGATGCTGCGTTCTGCGGATCGCGCCAACAAAAAATTCAAGATGCACTTTCTCCCCAATCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail