Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3015
Gene name
LocationContig_221:748..1531
Strand-
Gene length (bp)783
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 2.5E-06 110 183
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 2.5E-07 114 178

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016407 acetyltransferase activity No
GO:0016410 N-acyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6552
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3015 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5791
Ophiocordyceps subramaniannii Hirsu2|2148

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3015
MAPATSQDVPALASLLFEDFMEQDAWTKLCFGDMDPPDRLTYYIAGLREDIENPEYPMVVQKMQDDATGEAVAFT
EIKDGNVAPLERDFVEPMVKPKGYNVGPIRENHGKMVAALKRAMGEEKPFLYLVDMTTKKSHRRRGIATTLMQWA
MEMATRRQLPIYCEASADGHGLYKHLGWEVVESWSVDMGQYGGEGIYTEWGMRWTPPLGQAEA*
Coding >OphauG2|3015
ATGGCACCGGCCACGTCTCAAGACGTGCCCGCGCTGGCATCGCTCCTCTTTGAAGATTTCATGGAGCAAGATGCC
TGGACCAAGCTGTGCTTTGGCGACATGGATCCACCGGACCGACTGACGTACTACATTGCCGGGCTCAGAGAGGAC
ATTGAGAACCCAGAGTATCCCATGGTGGTGCAAAAGATGCAGGATGACGCGACGGGCGAGGCGGTGGCCTTTACG
GAGATCAAGGACGGCAATGTGGCGCCGCTGGAGCGCGACTTTGTCGAGCCCATGGTGAAGCCCAAGGGGTATAAT
GTTGGGCCGATTCGGGAGAACCATGGCAAGATGGTGGCGGCGCTGAAGCGAGCAATGGGCGAGGAGAAGCCGTTT
TTGTACCTTGTCGACATGACAACCAAGAAATCGCACAGGCGGCGCGGCATAGCTACTACGCTGATGCAATGGGCC
ATGGAAATGGCGACGCGGCGTCAGCTCCCCATCTACTGCGAGGCGTCGGCAGATGGACACGGGCTCTACAAGCAC
CTTGGCTGGGAGGTTGTCGAGAGCTGGTCGGTGGACATGGGCCAGTATGGCGGCGAGGGCATTTACACGGAATGG
GGCATGCGATGGACTCCGCCTCTGGGCCAGGCAGAAGCATAG
Transcript >OphauG2|3015
ATGGCACCGGCCACGTCTCAAGACGTGCCCGCGCTGGCATCGCTCCTCTTTGAAGATTTCATGGAGCAAGATGCC
TGGACCAAGCTGTGCTTTGGCGACATGGATCCACCGGACCGACTGACGTACTACATTGCCGGGCTCAGAGAGGAC
ATTGAGAACCCAGAGTATCCCATGGTGGTGCAAAAGATGCAGGATGACGCGACGGGCGAGGCGGTGGCCTTTACG
GAGATCAAGGACGGCAATGTGGCGCCGCTGGAGCGCGACTTTGTCGAGCCCATGGTGAAGCCCAAGGGGTATAAT
GTTGGGCCGATTCGGGAGAACCATGGCAAGATGGTGGCGGCGCTGAAGCGAGCAATGGGCGAGGAGAAGCCGTTT
TTGTACCTTGTCGACATGACAACCAAGAAATCGCACAGGCGGCGCGGCATAGCTACTACGCTGATGCAATGGGCC
ATGGAAATGGCGACGCGGCGTCAGCTCCCCATCTACTGCGAGGCGTCGGCAGATGGACACGGGCTCTACAAGCAC
CTTGGCTGGGAGGTTGTCGAGAGCTGGTCGGTGGACATGGGCCAGTATGGCGGCGAGGGCATTTACACGGAATGG
GGCATGCGATGGACTCCGCCTCTGGGCCAGGCAGAAGCATAG
Gene >OphauG2|3015
ATGGCACCGGCCACGTCTCAAGACGTGCCCGCGCTGGCATCGCTCCTCTTTGAAGATTTCATGGAGCAAGATGCC
TGGACCAAGCTGTGCTTTGGCGACATGGATCCACCGGACCGACTGACGTACTACATTGCCGGGCTCAGAGAGGAC
ATTGAGAACCCAGAGTATCCCATGGTGGTGCAAAAGATGCAGGATGACGCGACGGGCGAGGCGGTGGCCTTTACG
GAGATCAAGGACGGCAATGTGGCGCCGCTGGAGCGCGACTTTGTCGAGCCCATGGTGAAGCCCAAGGGGTATAAT
GTTGGGCCGATTCGGGAGAACCATGGCAAGATGGTGGCGGCGCTGAAGCGAGCAATGGGCGAGGAGAAGCCGTTT
TTGTGTGAGTAGGCCCTTTTTTCCCTCCAAGAGGATGGCTCCACGAGGATGGCTCCAAGAGGATAGCTCCAAGAG
GATAAAAAGAAGCCTAGACTCTTGGGTATACTTGGGGAGAGAAGCAAAAACCATGGCTCATGGCGTGCAGACCTT
GTCGACATGACAACCAAGAAATCGCACAGGCGGCGCGGCATAGCTACTACGCTGATGCAATGGGCCATGGAAATG
GCGACGCGGCGTCAGCTCCCCATCTACTGCGAGGCGTCGGCAGATGGACACGGGCTCTACAAGCACCTTGGCTGG
GAGGTTGTCGAGAGCTGGTCGGTGGACATGGGCCAGTATGGCGGCGAGGGCATTTACACGGAATGGGGCATGCGA
TGGACTCCGCCTCTGGGCCAGGCAGAAGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail