Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3007
Gene name
LocationContig_220:8415..9584
Strand+
Gene length (bp)1169
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01267 F-actin_cap_A F-actin capping protein alpha subunit 9.3E-96 7 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2D7|CAPZA_GIBZE F-actin-capping protein subunit alpha OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CAP1 PE=3 SV=1 1 272 1.0E-155
sp|Q9P5K9|CAPZA_NEUCR F-actin-capping protein subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fac-1 PE=3 SV=3 2 272 1.0E-152
sp|Q2UHU9|CAPZA_ASPOR F-actin-capping protein subunit alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cap1 PE=3 SV=1 4 271 2.0E-113
sp|Q5BBF4|CAPZA_EMENI F-actin-capping protein subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cap1 PE=3 SV=3 4 271 1.0E-112
sp|Q4WMF7|CAPZA_ASPFU F-actin-capping protein subunit alpha OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cap1 PE=3 SV=1 4 271 6.0E-101
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2D7|CAPZA_GIBZE F-actin-capping protein subunit alpha OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CAP1 PE=3 SV=1 1 272 1.0E-155
sp|Q9P5K9|CAPZA_NEUCR F-actin-capping protein subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fac-1 PE=3 SV=3 2 272 1.0E-152
sp|Q2UHU9|CAPZA_ASPOR F-actin-capping protein subunit alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cap1 PE=3 SV=1 4 271 2.0E-113
sp|Q5BBF4|CAPZA_EMENI F-actin-capping protein subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cap1 PE=3 SV=3 4 271 1.0E-112
sp|Q4WMF7|CAPZA_ASPFU F-actin-capping protein subunit alpha OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cap1 PE=3 SV=1 4 271 6.0E-101
sp|Q6C6Y4|CAPZA_YARLI F-actin-capping protein subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CAP1 PE=3 SV=2 5 268 9.0E-57
sp|P52907|CAZA1_HUMAN F-actin-capping protein subunit alpha-1 OS=Homo sapiens GN=CAPZA1 PE=1 SV=3 10 265 7.0E-53
sp|B2GUZ5|CAZA1_RAT F-actin-capping protein subunit alpha-1 OS=Rattus norvegicus GN=Capza1 PE=1 SV=1 10 265 1.0E-52
sp|P47753|CAZA1_MOUSE F-actin-capping protein subunit alpha-1 OS=Mus musculus GN=Capza1 PE=1 SV=4 10 265 1.0E-52
sp|A4FUA8|CAZA1_BOVIN F-actin-capping protein subunit alpha-1 OS=Bos taurus GN=CAPZA1 PE=2 SV=1 10 265 1.0E-52
sp|Q4R959|CAZA1_MACFA F-actin-capping protein subunit alpha-1 OS=Macaca fascicularis GN=CAPZA1 PE=2 SV=1 10 265 3.0E-52
sp|Q5NVM0|CAZA1_PONAB F-actin-capping protein subunit alpha-1 OS=Pongo abelii GN=CAPZA1 PE=2 SV=3 10 265 4.0E-52
sp|Q9W2N0|CAPZA_DROME F-actin-capping protein subunit alpha OS=Drosophila melanogaster GN=cpa PE=2 SV=1 7 265 5.0E-52
sp|P28497|CAZA2_CHICK F-actin-capping protein subunit alpha-2 OS=Gallus gallus GN=CAPZA2 PE=1 SV=1 10 265 5.0E-52
sp|Q6FN48|CAPZA_CANGA F-actin-capping protein subunit alpha OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAP1 PE=3 SV=1 7 268 1.0E-51
sp|P13127|CAZA1_CHICK F-actin-capping protein subunit alpha-1 OS=Gallus gallus GN=CAPZA1 PE=1 SV=1 10 265 1.0E-51
sp|P34685|CAPZA_CAEEL F-actin-capping protein subunit alpha OS=Caenorhabditis elegans GN=cap-1 PE=2 SV=1 8 265 6.0E-51
sp|Q07E00|CAZA2_ORNAN F-actin-capping protein subunit alpha-2 OS=Ornithorhynchus anatinus GN=CAPZA2 PE=3 SV=3 10 265 1.0E-50
sp|Q00PJ7|CAZA2_ATEAB F-actin-capping protein subunit alpha-2 OS=Atelerix albiventris GN=CAPZA2 PE=3 SV=1 10 265 4.0E-50
sp|Q2QLB9|CAZA2_CALMO F-actin-capping protein subunit alpha-2 OS=Callicebus moloch GN=CAPZA2 PE=3 SV=3 10 265 9.0E-50
sp|Q5E997|CAZA2_BOVIN F-actin-capping protein subunit alpha-2 OS=Bos taurus GN=CAPZA2 PE=1 SV=3 10 265 2.0E-49
sp|Q2QL78|CAZA2_DIDVI F-actin-capping protein subunit alpha-2 OS=Didelphis virginiana GN=CAPZA2 PE=3 SV=3 10 265 2.0E-49
sp|Q2QLA8|CAZA2_HORSE F-actin-capping protein subunit alpha-2 OS=Equus caballus GN=CAPZA2 PE=3 SV=3 10 265 2.0E-49
sp|Q108U5|CAZA2_LOXAF F-actin-capping protein subunit alpha-2 OS=Loxodonta africana GN=CAPZA2 PE=3 SV=3 10 265 2.0E-49
sp|Q2QLD1|CAZA2_CARPS F-actin-capping protein subunit alpha-2 OS=Carollia perspicillata GN=CAPZA2 PE=3 SV=3 10 265 2.0E-49
sp|Q09YJ9|CAZA2_MUNMU F-actin-capping protein subunit alpha-2 OS=Muntiacus muntjak GN=CAPZA2 PE=3 SV=3 10 265 2.0E-49
sp|Q2QL99|CAZA2_MONDO F-actin-capping protein subunit alpha-2 OS=Monodelphis domestica GN=CAPZA2 PE=3 SV=3 10 265 3.0E-49
sp|A1X151|CAZA2_ECHTE F-actin-capping protein subunit alpha-2 OS=Echinops telfairi GN=CAPZA2 PE=3 SV=1 10 265 3.0E-49
sp|Q2IBB9|CAZA2_RHIFE F-actin-capping protein subunit alpha-2 OS=Rhinolophus ferrumequinum GN=CAPZA2 PE=3 SV=3 10 265 3.0E-49
sp|Q29221|CAZA2_PIG F-actin-capping protein subunit alpha-2 OS=Sus scrofa GN=CAPZA2 PE=2 SV=3 10 265 4.0E-49
sp|Q07E23|CAZA2_MUSPF F-actin-capping protein subunit alpha-2 OS=Mustela putorius furo GN=CAPZA2 PE=3 SV=3 10 265 4.0E-49
sp|A0M8V0|CAZA2_CANLF F-actin-capping protein subunit alpha-2 OS=Canis lupus familiaris GN=CAPZA2 PE=3 SV=1 10 265 4.0E-49
sp|A0M8S9|CAZA2_FELCA F-actin-capping protein subunit alpha-2 OS=Felis catus GN=CAPZA2 PE=3 SV=1 10 265 4.0E-49
sp|Q07E36|CAZA2_NEONE F-actin-capping protein subunit alpha-2 OS=Neofelis nebulosa GN=CAPZA2 PE=3 SV=3 10 265 4.0E-49
sp|A4D7S9|CAZA2_MACEU F-actin-capping protein subunit alpha-2 OS=Macropus eugenii GN=CAPZA2 PE=3 SV=1 10 265 5.0E-49
sp|Q2IBA7|CAZA2_CHLAE F-actin-capping protein subunit alpha-2 OS=Chlorocebus aethiops GN=CAPZA2 PE=3 SV=3 10 265 5.0E-49
sp|Q07DZ0|CAZA2_COLGU F-actin-capping protein subunit alpha-2 OS=Colobus guereza GN=CAPZA2 PE=3 SV=3 10 265 5.0E-49
sp|Q2IBE7|CAZA2_GORGO F-actin-capping protein subunit alpha-2 OS=Gorilla gorilla gorilla GN=CAPZA2 PE=3 SV=3 10 265 5.0E-49
sp|P47755|CAZA2_HUMAN F-actin-capping protein subunit alpha-2 OS=Homo sapiens GN=CAPZA2 PE=1 SV=3 10 265 5.0E-49
sp|Q2QLF0|CAZA2_PANTR F-actin-capping protein subunit alpha-2 OS=Pan troglodytes GN=CAPZA2 PE=3 SV=3 10 265 5.0E-49
sp|A0M8R8|CAZA2_PAPAN F-actin-capping protein subunit alpha-2 OS=Papio anubis GN=CAPZA2 PE=3 SV=1 10 265 5.0E-49
sp|Q5R4P6|CAZA2_PONAB F-actin-capping protein subunit alpha-2 OS=Pongo abelii GN=CAPZA2 PE=2 SV=4 10 265 5.0E-49
sp|Q4R5G1|CAZA2_MACFA F-actin-capping protein subunit alpha-2 OS=Macaca fascicularis GN=CAPZA2 PE=2 SV=3 10 265 5.0E-49
sp|Q07DY0|CAZA2_NOMLE F-actin-capping protein subunit alpha-2 OS=Nomascus leucogenys GN=CAPZA2 PE=3 SV=3 10 265 5.0E-49
sp|Q3T1K5|CAZA2_RAT F-actin-capping protein subunit alpha-2 OS=Rattus norvegicus GN=Capza2 PE=1 SV=1 10 265 6.0E-49
sp|P47754|CAZA2_MOUSE F-actin-capping protein subunit alpha-2 OS=Mus musculus GN=Capza2 PE=1 SV=3 10 265 6.0E-49
sp|Q09YN4|CAZA2_RABIT F-actin-capping protein subunit alpha-2 OS=Oryctolagus cuniculus GN=CAPZA2 PE=3 SV=3 10 265 6.0E-49
sp|Q07E47|CAZA2_DASNO F-actin-capping protein subunit alpha-2 OS=Dasypus novemcinctus GN=CAPZA2 PE=3 SV=3 10 265 6.0E-49
sp|Q09YH6|CAZA2_SAIBB F-actin-capping protein subunit alpha-2 OS=Saimiri boliviensis boliviensis GN=CAPZA2 PE=3 SV=3 10 265 6.0E-49
sp|Q2QLG4|CAZA2_CALJA F-actin-capping protein subunit alpha-2 OS=Callithrix jacchus GN=CAPZA2 PE=3 SV=3 10 265 6.0E-49
sp|Q09YL0|CAZA2_ATEGE F-actin-capping protein subunit alpha-2 OS=Ateles geoffroyi GN=CAPZA2 PE=3 SV=3 10 265 6.0E-49
sp|Q07DV7|CAZA2_AOTNA F-actin-capping protein subunit alpha-2 OS=Aotus nancymaae GN=CAPZA2 PE=3 SV=3 10 265 6.0E-49
sp|Q2QL88|CAZA2_MICMU F-actin-capping protein subunit alpha-2 OS=Microcebus murinus GN=CAPZA2 PE=3 SV=3 10 265 1.0E-48
sp|Q2QLH5|CAZA2_OTOGA F-actin-capping protein subunit alpha-2 OS=Otolemur garnettii GN=CAPZA2 PE=3 SV=3 10 265 1.0E-48
sp|A4D7Q3|CAZA2_ARTJA F-actin-capping protein subunit alpha-2 OS=Artibeus jamaicensis GN=CAPZA2 PE=3 SV=1 10 265 2.0E-48
sp|P28495|CAPZA_YEAST F-actin-capping protein subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAP1 PE=1 SV=1 5 268 8.0E-45
sp|P25229|CAZA1_XENLA F-actin-capping protein subunit alpha-1 (Fragment) OS=Xenopus laevis GN=capza1 PE=1 SV=1 43 265 2.0E-44
sp|Q10434|CAPZA_SCHPO F-actin-capping protein subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=acp1 PE=1 SV=1 5 261 6.0E-39
sp|O74232|CAPZA_KLULA F-actin-capping protein subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAP1 PE=3 SV=2 1 269 2.0E-38
sp|Q75DS4|CAPZA_ASHGO F-actin-capping protein subunit alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CAP1 PE=3 SV=1 5 268 2.0E-38
sp|P13022|CAPZA_DICDI F-actin-capping protein subunit alpha OS=Dictyostelium discoideum GN=acpB PE=1 SV=1 4 266 1.0E-31
sp|Q6BNP4|CAPZA_DEBHA F-actin-capping protein subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CAP1 PE=3 SV=2 7 265 1.0E-30
sp|O82631|CAPZA_ARATH F-actin-capping protein subunit alpha OS=Arabidopsis thaliana GN=At3g05520 PE=2 SV=2 5 265 4.0E-28
sp|Q5A893|CAPZA_CANAL F-actin-capping protein subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP1 PE=3 SV=1 5 265 2.0E-25
sp|Q9WUV6|CAZA3_RAT F-actin-capping protein subunit alpha-3 OS=Rattus norvegicus GN=Capza3 PE=1 SV=1 14 258 2.0E-24
sp|P70190|CAZA3_MOUSE F-actin-capping protein subunit alpha-3 OS=Mus musculus GN=Capza3 PE=2 SV=1 14 258 1.0E-23
sp|Q4R7M8|CAZA3_MACFA F-actin-capping protein subunit alpha-3 OS=Macaca fascicularis GN=CAPZA3 PE=2 SV=1 6 258 8.0E-22
sp|Q96KX2|CAZA3_HUMAN F-actin-capping protein subunit alpha-3 OS=Homo sapiens GN=CAPZA3 PE=1 SV=2 6 258 1.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0008290 F-actin capping protein complex Yes
GO:0051016 barbed-end actin filament capping Yes
GO:0032272 negative regulation of protein polymerization No
GO:0032956 regulation of actin cytoskeleton organization No
GO:0043242 negative regulation of protein-containing complex disassembly No
GO:0032991 protein-containing complex No
GO:0030837 negative regulation of actin filament polymerization No
GO:0032271 regulation of protein polymerization No
GO:0008150 biological_process No
GO:1901879 regulation of protein depolymerization No
GO:0065008 regulation of biological quality No
GO:0051494 negative regulation of cytoskeleton organization No
GO:0016043 cellular component organization No
GO:0050789 regulation of biological process No
GO:0110053 regulation of actin filament organization No
GO:0051693 actin filament capping No
GO:0010639 negative regulation of organelle organization No
GO:0043254 regulation of protein-containing complex assembly No
GO:0048519 negative regulation of biological process No
GO:0051493 regulation of cytoskeleton organization No
GO:0030835 negative regulation of actin filament depolymerization No
GO:0090066 regulation of anatomical structure size No
GO:0048523 negative regulation of cellular process No
GO:0032535 regulation of cellular component size No
GO:0030832 regulation of actin filament length No
GO:0032970 regulation of actin filament-based process No
GO:1902903 regulation of supramolecular fiber organization No
GO:0030833 regulation of actin filament polymerization No
GO:0031333 negative regulation of protein-containing complex assembly No
GO:0051129 negative regulation of cellular component organization No
GO:0044087 regulation of cellular component biogenesis No
GO:0008064 regulation of actin polymerization or depolymerization No
GO:0033043 regulation of organelle organization No
GO:1902904 negative regulation of supramolecular fiber organization No
GO:0071840 cellular component organization or biogenesis No
GO:0030834 regulation of actin filament depolymerization No
GO:0065007 biological regulation No
GO:0005575 cellular_component No
GO:1901880 negative regulation of protein depolymerization No
GO:0009987 cellular process No
GO:0043244 regulation of protein-containing complex disassembly No
GO:0051128 regulation of cellular component organization No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3007
MAHLETVTSFVQGAPPGELADVVADIKILTQASPNLVSELTPAFKQYNEEQLVTVKLPGSSEPVIVSTYNSLGDG
RYYDTESASSFAVEHQSQKASQVQSHVLEGQQADLAKSTLKSLGSYVKEHFKNASYSVYPIESDSKLAIIIVASK
YSPNNFWNGRWRSVHILDAASGSLEGTIKVDVHYYEDGNVRLLTNRPVTASIPSATGAAIAKEISTIEKKYQEEL
NKTFVKLSEGAFKGLRRQLPVTRQKIEWDKVASYRLGQDIGGGSSKR*
Coding >OphauG2|3007
ATGGCTCATCTCGAGACTGTCACGTCGTTTGTTCAAGGCGCTCCGCCAGGAGAGCTCGCAGACGTTGTAGCCGAC
ATCAAGATTTTAACACAAGCCTCGCCCAATCTCGTCTCCGAACTCACTCCGGCCTTCAAGCAGTACAACGAGGAA
CAGCTAGTGACAGTGAAGCTGCCTGGCAGCAGCGAACCGGTAATCGTCAGCACGTATAACTCGCTAGGAGACGGG
CGATACTACGATACCGAAAGTGCCTCGAGTTTCGCCGTAGAGCACCAGTCACAGAAAGCAAGTCAGGTGCAGAGC
CATGTCCTCGAGGGACAACAAGCAGACTTGGCAAAATCAACGCTCAAGAGTCTGGGAAGCTATGTCAAGGAGCAC
TTCAAAAACGCTTCGTATAGTGTGTATCCCATCGAGTCGGATTCCAAGCTCGCCATCATAATTGTTGCCAGCAAA
TACAGCCCAAACAACTTCTGGAATGGGCGGTGGAGGTCAGTGCACATACTTGATGCTGCATCAGGCAGTCTGGAG
GGGACCATCAAGGTCGATGTGCACTACTATGAAGATGGCAACGTACGACTTCTCACCAACAGGCCCGTCACAGCT
TCCATTCCATCAGCAACCGGTGCCGCCATTGCCAAGGAGATTTCGACAATAGAAAAGAAGTACCAAGAAGAACTC
AACAAGACGTTTGTCAAGCTCAGCGAAGGCGCCTTCAAGGGCCTCCGCCGACAGCTGCCGGTTACCAGACAAAAA
ATTGAGTGGGACAAGGTGGCAAGTTATCGTCTGGGGCAGGACATTGGCGGCGGGAGTAGCAAGCGGTAA
Transcript >OphauG2|3007
ATGGCTCATCTCGAGACTGTCACGTCGTTTGTTCAAGGCGCTCCGCCAGGAGAGCTCGCAGACGTTGTAGCCGAC
ATCAAGATTTTAACACAAGCCTCGCCCAATCTCGTCTCCGAACTCACTCCGGCCTTCAAGCAGTACAACGAGGAA
CAGCTAGTGACAGTGAAGCTGCCTGGCAGCAGCGAACCGGTAATCGTCAGCACGTATAACTCGCTAGGAGACGGG
CGATACTACGATACCGAAAGTGCCTCGAGTTTCGCCGTAGAGCACCAGTCACAGAAAGCAAGTCAGGTGCAGAGC
CATGTCCTCGAGGGACAACAAGCAGACTTGGCAAAATCAACGCTCAAGAGTCTGGGAAGCTATGTCAAGGAGCAC
TTCAAAAACGCTTCGTATAGTGTGTATCCCATCGAGTCGGATTCCAAGCTCGCCATCATAATTGTTGCCAGCAAA
TACAGCCCAAACAACTTCTGGAATGGGCGGTGGAGGTCAGTGCACATACTTGATGCTGCATCAGGCAGTCTGGAG
GGGACCATCAAGGTCGATGTGCACTACTATGAAGATGGCAACGTACGACTTCTCACCAACAGGCCCGTCACAGCT
TCCATTCCATCAGCAACCGGTGCCGCCATTGCCAAGGAGATTTCGACAATAGAAAAGAAGTACCAAGAAGAACTC
AACAAGACGTTTGTCAAGCTCAGCGAAGGCGCCTTCAAGGGCCTCCGCCGACAGCTGCCGGTTACCAGACAAAAA
ATTGAGTGGGACAAGGTGGCAAGTTATCGTCTGGGGCAGGACATTGGCGGCGGGAGTAGCAAGCGGTAA
Gene >OphauG2|3007
ATGGCTCATCTCGAGACTGTCACGTCGTTTGTTCAAGGCGCTCCGCCAGGAGAGGTAGGCCCTGCTCATCCAGGT
CAATGCCGCTGCCATGCGGACTGCTAACCCGTCGACGTGGAAAGCTCGCAGACGTTGTAGCCGGTATAGCATTAT
TCGGATAGCCATAAACACACAGCAGTCGGCTAAGAAATATCTACAGACATCAAGATTTTAACACAAGCCTCGCCC
AATCTCGTCTCCGAACTCACTCCGGCCTTCAAGCAGTACAACGAGGAACAGCTAGTGACAGTGAAGCTGCCTGGC
AGCAGCGAACCGGTACGCCGCCAGCGCCATATACTACTACATGTTGGCAATGCAACTAATTGGTGGCAAGGTAAT
CGTCAGCACGTATAACTCGCTAGGAGACGGGCGATACTACGATACCGAAAGTGCCTCGAGTTTCGCCGTAGAGCA
CCAGTCACAGGCAAGTGCAACAATGATGGCATCCAAATTCAGACGAAAGGCTGACTGGCACGGTATAGAAAGCAA
GTCAGGTGCAGAGCCATGTCCTCGAGGGACAACAAGCAGACTTGGCGTGAGTGCTACGCGATGGGAATGGATTGA
GCCAATCAAGTGTGCTGAAGCACGACAGAAAATCAACGCTCAAGAGTCTGGGAAGCTATGTCAAGGAGCACTTCA
AAAACGCTTCGTATAGTGTGTATCCCATCGAGTCGGATTCCAAGCTCGCCATCATAATTGTTGCCAGCAAATACA
GCCCAAACAACTTCTGGTGAGCCGGCACACATGCCACACGCGCCCATGTGGAAACTGACGCGACCATCAGGAATG
GGCGGTGGAGGTCAGTGCACATACTTGATGCTGCATCAGGCAGTCTGGAGGGGACCATCAAGGTCGATGTGCACT
ACTATGAAGATGGCAACGTACGACTTCTCACCAACAGGCCCGTCACAGCTTCCATTCCATCAGCAACCGGTGCCG
CCATTGCCAAGGAGATTTCGACAATAGAAAAGAAGTACCAAGAAGAACTCAACAAGACGTTTGTCAAGCTCAGCG
AAGGCGCCTTCAAGGGCCTCCGCCGACAGCTGCCGGTTACCAGACAAAAAATTGAGTGGGACAAGGTGGCAAGTT
ATCGTCTGGGGCAGGACATTGGCGGCGGGAGTAGCAAGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail