Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|3001
Gene name
LocationContig_22:43620..46632
Strand-
Gene length (bp)3012
Transcript length (bp)2892
Coding sequence length (bp)2892
Protein length (aa) 964

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 6.2E-143 30 659
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 8.3E-11 51 192
PF08264 Anticodon_1 Anticodon-binding domain of tRNA ligase 1.7E-17 698 789

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USL3|SYIM_SCHPO Isoleucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ism1 PE=3 SV=1 2 945 0.0E+00
sp|B0C872|SYI_ACAM1 Isoleucine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=ileS PE=3 SV=1 44 947 0.0E+00
sp|B0JSP4|SYI_MICAN Isoleucine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=ileS PE=3 SV=1 2 948 0.0E+00
sp|Q8DGI7|SYI_THEEB Isoleucine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=ileS PE=3 SV=2 2 941 0.0E+00
sp|B2IZP5|SYI_NOSP7 Isoleucine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ileS PE=3 SV=1 2 941 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USL3|SYIM_SCHPO Isoleucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ism1 PE=3 SV=1 2 945 0.0E+00
sp|B0C872|SYI_ACAM1 Isoleucine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=ileS PE=3 SV=1 44 947 0.0E+00
sp|B0JSP4|SYI_MICAN Isoleucine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=ileS PE=3 SV=1 2 948 0.0E+00
sp|Q8DGI7|SYI_THEEB Isoleucine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=ileS PE=3 SV=2 2 941 0.0E+00
sp|B2IZP5|SYI_NOSP7 Isoleucine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ileS PE=3 SV=1 2 941 0.0E+00
sp|B8HMX3|SYI_CYAP4 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ileS PE=3 SV=1 2 947 0.0E+00
sp|B1WVA3|SYI_CYAA5 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=ileS PE=3 SV=1 2 941 0.0E+00
sp|B7K5H5|SYI_CYAP8 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=ileS PE=3 SV=1 2 941 0.0E+00
sp|Q8YXY3|SYI_NOSS1 Isoleucine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ileS PE=3 SV=1 2 941 0.0E+00
sp|Q5N1G1|SYI_SYNP6 Isoleucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ileS PE=3 SV=1 35 946 0.0E+00
sp|P48526|SYIM_YEAST Isoleucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISM1 PE=1 SV=2 2 945 0.0E+00
sp|Q7NF75|SYI_GLOVI Isoleucine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=ileS PE=3 SV=1 2 945 0.0E+00
sp|B7KFT1|SYI_CYAP7 Isoleucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=ileS PE=3 SV=1 44 948 0.0E+00
sp|Q7U9G9|SYI_SYNPX Isoleucine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=ileS PE=3 SV=1 43 948 0.0E+00
sp|P73505|SYI_SYNY3 Isoleucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ileS PE=3 SV=1 2 946 0.0E+00
sp|Q8RXK8|SYIM_ARATH Isoleucine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA2 PE=2 SV=1 2 945 0.0E+00
sp|Q7TUN3|SYI_PROMM Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=ileS PE=3 SV=1 42 948 0.0E+00
sp|B9IVX2|SYI_BACCQ Isoleucine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=ileS PE=3 SV=1 2 948 0.0E+00
sp|B7HLM9|SYI_BACC7 Isoleucine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=ileS PE=3 SV=1 2 948 0.0E+00
sp|B7H6N1|SYI_BACC4 Isoleucine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=ileS PE=3 SV=1 2 948 0.0E+00
sp|Q819R4|SYI1_BACCR Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ileS1 PE=3 SV=1 2 948 0.0E+00
sp|Q636D1|SYI1_BACCZ Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=ileS1 PE=3 SV=1 2 948 0.0E+00
sp|Q46HD5|SYI_PROMT Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=ileS PE=3 SV=1 39 945 0.0E+00
sp|A9BDK6|SYI_PROM4 Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=ileS PE=3 SV=1 43 947 0.0E+00
sp|Q6HER9|SYI1_BACHK Isoleucine--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ileS1 PE=3 SV=1 2 948 0.0E+00
sp|C1EPQ9|SYI_BACC3 Isoleucine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=ileS PE=3 SV=1 2 948 0.0E+00
sp|Q732H4|SYI1_BACC1 Isoleucine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ileS1 PE=3 SV=1 2 948 0.0E+00
sp|B7JJY2|SYI_BACC0 Isoleucine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=ileS PE=3 SV=1 2 948 0.0E+00
sp|Q7VDV0|SYI_PROMA Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ileS PE=3 SV=1 43 947 0.0E+00
sp|B7IUQ5|SYI_BACC2 Isoleucine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=ileS PE=3 SV=1 2 948 0.0E+00
sp|C3L730|SYI_BACAC Isoleucine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ileS PE=3 SV=1 2 948 2.0E-180
sp|C3P665|SYI_BACAA Isoleucine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=ileS PE=3 SV=1 2 948 2.0E-180
sp|Q81WE4|SYI1_BACAN Isoleucine--tRNA ligase 1 OS=Bacillus anthracis GN=ileS1 PE=3 SV=1 2 948 2.0E-180
sp|A9VTD5|SYI_BACWK Isoleucine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ileS PE=3 SV=1 2 948 5.0E-179
sp|A2C071|SYI_PROM1 Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=ileS PE=3 SV=1 39 945 1.0E-178
sp|C5D8P2|SYI_GEOSW Isoleucine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=ileS PE=3 SV=1 2 951 1.0E-177
sp|A7GRM0|SYI_BACCN Isoleucine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ileS PE=3 SV=1 2 948 3.0E-177
sp|A5IML2|SYI_THEP1 Isoleucine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=ileS PE=3 SV=1 2 950 3.0E-177
sp|P46213|SYI_THEMA Isoleucine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ileS PE=3 SV=2 2 950 5.0E-177
sp|B9K8X3|SYI_THENN Isoleucine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=ileS PE=3 SV=1 2 950 6.0E-177
sp|Q3AEP2|SYI_CARHZ Isoleucine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=ileS PE=3 SV=1 2 945 1.0E-176
sp|C5CHA1|SYI_KOSOT Isoleucine--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ileS PE=3 SV=1 2 947 9.0E-175
sp|A4IM25|SYI_GEOTN Isoleucine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ileS PE=3 SV=1 2 951 6.0E-174
sp|Q7V352|SYI_PROMP Isoleucine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ileS PE=3 SV=1 39 946 1.0E-173
sp|Q5L0V9|SYI_GEOKA Isoleucine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=ileS PE=3 SV=1 2 951 2.0E-173
sp|A2BUL8|SYI_PROM5 Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=ileS PE=3 SV=1 42 945 4.0E-173
sp|A6LK77|SYI_THEM4 Isoleucine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=ileS PE=3 SV=1 2 950 5.0E-173
sp|C0ZG86|SYI_BREBN Isoleucine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ileS PE=3 SV=1 2 948 2.0E-172
sp|Q67Q27|SYI_SYMTH Isoleucine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ileS PE=3 SV=1 2 945 3.0E-171
sp|Q5HPZ9|SYI_STAEQ Isoleucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ileS PE=3 SV=1 2 946 4.0E-171
sp|B2A2I8|SYI_NATTJ Isoleucine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ileS PE=3 SV=1 2 946 7.0E-171
sp|Q8CSX1|SYI_STAES Isoleucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ileS PE=3 SV=1 2 946 1.0E-170
sp|C0QP76|SYI_PERMH Isoleucine--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=ileS PE=3 SV=1 2 949 3.0E-170
sp|A4J2F4|SYI_DESRM Isoleucine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=ileS PE=3 SV=1 2 951 3.0E-170
sp|Q0IDA5|SYI_SYNS3 Isoleucine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=ileS PE=3 SV=1 44 948 5.0E-170
sp|Q4R646|SYIM_MACFA Isoleucine--tRNA ligase, mitochondrial (Fragment) OS=Macaca fascicularis GN=IARS2 PE=2 SV=2 2 945 4.0E-169
sp|Q4L5P4|SYI_STAHJ Isoleucine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ileS PE=3 SV=1 2 946 2.0E-168
sp|Q2RK59|SYI_MOOTA Isoleucine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=ileS PE=3 SV=1 2 947 3.0E-168
sp|Q49WX5|SYI_STAS1 Isoleucine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ileS PE=3 SV=1 2 946 4.0E-168
sp|Q9XDB4|SYI_FERPD Isoleucine--tRNA ligase OS=Fervidobacterium pennivorans (strain DSM 9078 / Ven5) GN=ileS PE=3 SV=3 2 950 8.0E-168
sp|Q0AYC7|SYI_SYNWW Isoleucine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=ileS PE=3 SV=1 2 949 1.0E-167
sp|Q8ER41|SYI1_OCEIH Isoleucine--tRNA ligase 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ileS1 PE=3 SV=1 2 948 5.0E-167
sp|Q9NSE4|SYIM_HUMAN Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens GN=IARS2 PE=1 SV=2 2 945 9.0E-167
sp|Q8BIJ6|SYIM_MOUSE Isoleucine--tRNA ligase, mitochondrial OS=Mus musculus GN=Iars2 PE=1 SV=1 2 945 2.0E-166
sp|Q9K9V0|SYI_BACHD Isoleucine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ileS PE=3 SV=1 2 945 2.0E-166
sp|A0AKC5|SYI_LISW6 Isoleucine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ileS PE=3 SV=1 2 951 2.0E-166
sp|Q5ZKA2|SYIM_CHICK Isoleucine--tRNA ligase, mitochondrial OS=Gallus gallus GN=IARS2 PE=2 SV=1 33 945 3.0E-166
sp|Q8RH47|SYI_FUSNN Isoleucine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=ileS PE=3 SV=1 2 946 4.0E-166
sp|Q6GHP2|SYI_STAAR Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|P41972|SYI1_STAAU Isoleucine--tRNA ligase OS=Staphylococcus aureus GN=ileS PE=1 SV=1 2 946 5.0E-166
sp|A8Z3N1|SYI_STAAT Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|P67509|SYI_STAAN Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=ileS PE=1 SV=1 2 946 5.0E-166
sp|P67508|SYI_STAAM Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|A6QG93|SYI_STAAE Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|Q5HGN8|SYI_STAAC Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|A5IS79|SYI_STAA9 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|Q2FZ82|SYI_STAA8 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|Q2FHP4|SYI_STAA3 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|A6U113|SYI_STAA2 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|A7X1D8|SYI_STAA1 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ileS PE=3 SV=1 2 946 5.0E-166
sp|B8CWL4|SYI_HALOH Isoleucine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ileS PE=3 SV=1 2 948 5.0E-166
sp|Q8NX29|SYI_STAAW Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=ileS PE=3 SV=1 2 946 6.0E-166
sp|Q6GA19|SYI_STAAS Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=ileS PE=3 SV=1 2 946 6.0E-166
sp|B7IGT1|SYI_THEAB Isoleucine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=ileS PE=3 SV=1 2 946 1.0E-165
sp|Q2YXH4|SYI_STAAB Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ileS PE=3 SV=1 2 946 1.0E-165
sp|A2BP36|SYI_PROMS Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=ileS PE=3 SV=1 39 946 1.0E-165
sp|Q1MPH2|SYI_LAWIP Isoleucine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=ileS PE=3 SV=1 2 949 1.0E-165
sp|A9BI29|SYI_PETMO Isoleucine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ileS PE=3 SV=1 2 951 1.0E-165
sp|Q54CE4|SYIM_DICDI Probable isoleucine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=mileS PE=3 SV=1 5 946 2.0E-165
sp|A3PAV8|SYI_PROM0 Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=ileS PE=3 SV=1 33 945 4.0E-165
sp|A7HMY6|SYI_FERNB Isoleucine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=ileS PE=3 SV=1 2 950 4.0E-165
sp|B2V9T1|SYI_SULSY Isoleucine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=ileS PE=3 SV=1 2 941 5.0E-165
sp|Q929Z6|SYI_LISIN Isoleucine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ileS PE=3 SV=1 2 951 3.0E-164
sp|Q3A1R3|SYI_PELCD Isoleucine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ileS PE=3 SV=1 2 945 5.0E-164
sp|B4U8K1|SYI_HYDS0 Isoleucine--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ileS PE=3 SV=1 2 942 5.0E-164
sp|A8G2P6|SYI_PROM2 Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=ileS PE=3 SV=1 39 945 6.0E-164
sp|Q8Y5N8|SYI_LISMO Isoleucine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ileS PE=3 SV=1 2 951 7.0E-164
sp|Q6AK45|SYI_DESPS Isoleucine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ileS PE=3 SV=1 2 954 9.0E-164
sp|Q71Y01|SYI_LISMF Isoleucine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ileS PE=3 SV=1 2 951 1.0E-163
sp|C1KWW3|SYI_LISMC Isoleucine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ileS PE=3 SV=1 2 951 1.0E-163
sp|B5FA60|SYI_VIBFM Isoleucine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=ileS PE=3 SV=1 2 950 1.0E-163
sp|B9DPP7|SYI_STACT Isoleucine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=ileS PE=3 SV=1 2 945 2.0E-163
sp|B8DBR2|SYI_LISMH Isoleucine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=ileS PE=3 SV=1 2 951 3.0E-163
sp|B9EB60|SYI_MACCJ Isoleucine--tRNA ligase OS=Macrococcus caseolyticus (strain JCSC5402) GN=ileS PE=3 SV=1 2 948 6.0E-163
sp|Q5E7N4|SYI_VIBF1 Isoleucine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ileS PE=3 SV=1 2 950 2.0E-162
sp|A1AW09|SYI_RUTMC Isoleucine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=ileS PE=3 SV=1 2 955 2.0E-162
sp|Q5WFI3|SYI_BACSK Isoleucine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=ileS PE=3 SV=1 2 948 5.0E-162
sp|Q45477|SYI_BACSU Isoleucine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=ileS PE=3 SV=3 2 947 6.0E-162
sp|Q65JV7|SYI_BACLD Isoleucine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ileS PE=3 SV=1 2 946 8.0E-162
sp|Q31CU4|SYI_PROM9 Isoleucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=ileS PE=3 SV=1 39 945 2.0E-161
sp|A4XKR2|SYI_CALS8 Isoleucine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=ileS PE=3 SV=1 2 946 1.0E-160
sp|B9MRZ5|SYI_CALBD Isoleucine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ileS PE=3 SV=1 2 948 2.0E-160
sp|B0K2W1|SYI_THEPX Isoleucine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=ileS PE=3 SV=1 2 951 4.0E-160
sp|B0K8R7|SYI_THEP3 Isoleucine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ileS PE=3 SV=1 2 951 4.0E-160
sp|B0TZQ5|SYI_FRAP2 Isoleucine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ileS PE=3 SV=1 2 945 4.0E-160
sp|O66651|SYI_AQUAE Isoleucine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=ileS PE=3 SV=1 3 942 6.0E-160
sp|A8F465|SYI_PSELT Isoleucine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ileS PE=3 SV=1 2 949 1.0E-159
sp|Q6YR34|SYI_ONYPE Isoleucine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=ileS PE=3 SV=1 2 946 1.0E-159
sp|A7MTD6|SYI_VIBCB Isoleucine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ileS PE=3 SV=1 2 950 2.0E-159
sp|Q4QLU5|SYI_HAEI8 Isoleucine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=ileS PE=3 SV=1 2 945 2.0E-159
sp|Q72AR5|SYI_DESVH Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ileS PE=3 SV=1 2 945 2.0E-159
sp|A1WY38|SYI_HALHL Isoleucine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ileS PE=3 SV=1 2 950 3.0E-159
sp|B8FT35|SYI_DESHD Isoleucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=ileS PE=3 SV=1 2 945 3.0E-159
sp|A1VCU3|SYI_DESVV Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ileS PE=3 SV=1 2 945 3.0E-159
sp|Q846V6|SYI_STAEP Isoleucine--tRNA ligase OS=Staphylococcus epidermidis GN=ileS PE=3 SV=1 2 885 3.0E-159
sp|P43824|SYI_HAEIN Isoleucine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ileS PE=3 SV=2 2 945 3.0E-159
sp|B1I4A3|SYI_DESAP Isoleucine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=ileS PE=3 SV=1 2 945 4.0E-159
sp|Q87S90|SYI_VIBPA Isoleucine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ileS PE=3 SV=1 2 950 4.0E-159
sp|Q24TH1|SYI_DESHY Isoleucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=ileS PE=3 SV=1 2 945 4.0E-159
sp|A5UIA3|SYI_HAEIG Isoleucine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=ileS PE=3 SV=1 2 945 5.0E-159
sp|B6EMY6|SYI_ALISL Isoleucine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=ileS PE=3 SV=1 2 950 5.0E-159
sp|Q74JX6|SYI_LACJO Isoleucine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ileS PE=3 SV=2 3 945 7.0E-159
sp|A8YUP7|SYI_LACH4 Isoleucine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=ileS PE=3 SV=1 3 946 1.0E-158
sp|A6Q4I1|SYI_NITSB Isoleucine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=ileS PE=3 SV=1 2 951 2.0E-158
sp|B0TJA9|SYI_SHEHH Isoleucine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ileS PE=3 SV=1 2 955 2.0E-158
sp|B8DPD6|SYI_DESVM Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ileS PE=3 SV=1 2 946 7.0E-158
sp|C3LST7|SYI_VIBCM Isoleucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ileS PE=3 SV=1 2 955 1.0E-157
sp|Q9KU47|SYI_VIBCH Isoleucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ileS PE=3 SV=1 2 955 1.0E-157
sp|A5UDA6|SYI_HAEIE Isoleucine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=ileS PE=3 SV=1 2 945 1.0E-157
sp|A1SZP3|SYI_PSYIN Isoleucine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=ileS PE=3 SV=1 2 950 2.0E-157
sp|A5F8Z3|SYI_VIBC3 Isoleucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ileS PE=3 SV=1 2 950 4.0E-157
sp|A0Q529|SYI_FRATN Isoleucine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=ileS PE=3 SV=1 2 945 4.0E-157
sp|Q8R9L3|SYI_CALS4 Isoleucine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ileS PE=3 SV=1 2 948 4.0E-157
sp|B1YIS7|SYI_EXIS2 Isoleucine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=ileS PE=3 SV=1 35 946 7.0E-157
sp|Q9CEH8|SYI_LACLA Isoleucine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ileS PE=3 SV=1 3 948 2.0E-156
sp|B7VJ87|SYI_VIBTL Isoleucine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=ileS PE=3 SV=1 2 950 3.0E-156
sp|Q053V3|SYI_LEPBL Isoleucine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=ileS PE=3 SV=1 35 945 3.0E-156
sp|Q04QS6|SYI_LEPBJ Isoleucine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ileS PE=3 SV=1 35 945 3.0E-156
sp|Q5FKU5|SYI_LACAC Isoleucine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=ileS PE=3 SV=1 3 961 4.0E-156
sp|A4IYP1|SYI_FRATW Isoleucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ileS PE=3 SV=1 2 945 7.0E-156
sp|B8CSC1|SYI_SHEPW Isoleucine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ileS PE=3 SV=1 2 955 1.0E-155
sp|Q5NGD0|SYI_FRATT Isoleucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ileS PE=3 SV=1 2 948 2.0E-155
sp|Q14HT2|SYI_FRAT1 Isoleucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ileS PE=3 SV=1 2 948 2.0E-155
sp|B0STE5|SYI_LEPBP Isoleucine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=ileS PE=3 SV=1 40 947 2.0E-155
sp|B0SBW4|SYI_LEPBA Isoleucine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=ileS PE=3 SV=1 40 947 2.0E-155
sp|Q65RQ2|SYI_MANSM Isoleucine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=ileS PE=3 SV=1 2 950 2.0E-155
sp|Q3J8W1|SYI_NITOC Isoleucine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ileS PE=3 SV=1 2 943 2.0E-155
sp|Q7MNM8|SYI_VIBVY Isoleucine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=ileS PE=3 SV=1 2 955 4.0E-155
sp|Q8DES7|SYI_VIBVU Isoleucine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=ileS PE=3 SV=1 2 955 6.0E-155
sp|Q0BNB5|SYI_FRATO Isoleucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ileS PE=3 SV=1 2 948 6.0E-155
sp|Q2A4Z4|SYI_FRATH Isoleucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ileS PE=3 SV=1 2 948 6.0E-155
sp|A7NAD2|SYI_FRATF Isoleucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ileS PE=3 SV=1 2 948 6.0E-155
sp|B2SF88|SYI_FRATM Isoleucine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ileS PE=3 SV=1 2 945 1.0E-154
sp|Q6LUL1|SYI_PHOPR Isoleucine--tRNA ligase OS=Photobacterium profundum GN=ileS PE=3 SV=1 2 950 2.0E-154
sp|Q5QZS6|SYI_IDILO Isoleucine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ileS PE=3 SV=1 2 950 3.0E-154
sp|B3DYQ6|SYI_METI4 Isoleucine--tRNA ligase OS=Methylacidiphilum infernorum (isolate V4) GN=ileS PE=3 SV=1 5 951 4.0E-154
sp|Q1WTA9|SYI_LACS1 Isoleucine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=ileS PE=3 SV=1 3 948 7.0E-154
sp|C6BV89|SYI_DESAD Isoleucine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ileS PE=3 SV=1 2 945 7.0E-154
sp|A5CX61|SYI_VESOH Isoleucine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=ileS PE=3 SV=1 2 955 1.0E-153
sp|Q8F6I1|SYI_LEPIN Isoleucine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=ileS PE=3 SV=1 2 945 2.0E-153
sp|Q72PR7|SYI_LEPIC Isoleucine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=ileS PE=3 SV=1 2 945 2.0E-153
sp|Q747X9|SYI_GEOSL Isoleucine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ileS PE=3 SV=1 2 946 2.0E-153
sp|Q1GAS8|SYI_LACDA Isoleucine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ileS PE=3 SV=1 3 945 9.0E-153
sp|B8J3R3|SYI_DESDA Isoleucine--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=ileS PE=3 SV=1 2 949 1.0E-152
sp|Q04B65|SYI_LACDB Isoleucine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ileS PE=3 SV=1 3 945 1.0E-152
sp|A8H1H3|SYI_SHEPA Isoleucine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ileS PE=3 SV=1 2 955 2.0E-152
sp|B2G6L2|SYI_LACRJ Isoleucine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=ileS PE=3 SV=1 3 954 2.0E-152
sp|A9NG38|SYI_ACHLI Isoleucine--tRNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=ileS PE=3 SV=1 2 946 2.0E-152
sp|Q7VP34|SYI_HAEDU Isoleucine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ileS PE=3 SV=1 2 950 7.0E-152
sp|B8F5E2|SYI_HAEPS Isoleucine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=ileS PE=3 SV=1 2 955 7.0E-152
sp|A1S425|SYI_SHEAM Isoleucine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ileS PE=3 SV=1 2 951 8.0E-152
sp|A3D1G5|SYI_SHEB5 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ileS PE=3 SV=1 2 950 1.0E-151
sp|A9L4U7|SYI_SHEB9 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=ileS PE=3 SV=1 2 950 1.0E-151
sp|B8EFC7|SYI_SHEB2 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=ileS PE=3 SV=1 2 950 2.0E-151
sp|A6WKD4|SYI_SHEB8 Isoleucine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=ileS PE=3 SV=1 2 950 2.0E-151
sp|A1RMM6|SYI_SHESW Isoleucine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=ileS PE=3 SV=1 2 955 2.0E-151
sp|A4Y4A4|SYI_SHEPC Isoleucine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ileS PE=3 SV=1 2 955 2.0E-151
sp|Q8EBI4|SYI_SHEON Isoleucine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=ileS PE=3 SV=1 2 950 2.0E-151
sp|Q9CKF7|SYI_PASMU Isoleucine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=ileS PE=3 SV=1 2 955 2.0E-151
sp|Q3SHS3|SYI_THIDA Isoleucine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ileS PE=3 SV=1 2 951 3.0E-151
sp|B9L8Z9|SYI_NAUPA Isoleucine--tRNA ligase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=ileS PE=3 SV=1 2 945 4.0E-151
sp|A6W346|SYI_MARMS Isoleucine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=ileS PE=3 SV=1 2 941 7.0E-151
sp|A0RNK3|SYI_CAMFF Isoleucine--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=ileS PE=3 SV=1 2 947 8.0E-151
sp|A6QB84|SYI_SULNB Isoleucine--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=ileS PE=3 SV=1 2 945 9.0E-151
sp|Q326J7|SYI_SHIBS Isoleucine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=ileS PE=3 SV=1 2 950 9.0E-151
sp|C5B7M4|SYI_EDWI9 Isoleucine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=ileS PE=3 SV=1 2 950 1.0E-150
sp|A8ES62|SYI_ARCB4 Isoleucine--tRNA ligase OS=Arcobacter butzleri (strain RM4018) GN=ileS PE=3 SV=1 2 946 1.0E-150
sp|Q30ZF7|SYI_DESAG Isoleucine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=ileS PE=3 SV=1 2 945 1.0E-150
sp|B1IRE9|SYI_ECOLC Isoleucine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ileS PE=3 SV=1 2 950 2.0E-150
sp|B7LVN2|SYI_ESCF3 Isoleucine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ileS PE=3 SV=1 2 950 2.0E-150
sp|A7ZHB5|SYI_ECO24 Isoleucine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ileS PE=3 SV=1 2 950 2.0E-150
sp|Q32K71|SYI_SHIDS Isoleucine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ileS PE=3 SV=1 2 950 2.0E-150
sp|B4F2T5|SYI_PROMH Isoleucine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=ileS PE=3 SV=1 2 950 2.0E-150
sp|B2U245|SYI_SHIB3 Isoleucine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|Q3Z5Y4|SYI_SHISS Isoleucine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|B6HZ21|SYI_ECOSE Isoleucine--tRNA ligase OS=Escherichia coli (strain SE11) GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|P00956|SYI_ECOLI Isoleucine--tRNA ligase OS=Escherichia coli (strain K12) GN=ileS PE=1 SV=5 2 950 3.0E-150
sp|B1XBF1|SYI_ECODH Isoleucine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|C4ZPV2|SYI_ECOBW Isoleucine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|B7M0C2|SYI_ECO8A Isoleucine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|B7L4E8|SYI_ECO55 Isoleucine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|Q1RGH6|SYI_ECOUT Isoleucine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|A1A774|SYI_ECOK1 Isoleucine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|B7MAE6|SYI_ECO45 Isoleucine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ileS PE=3 SV=1 2 950 3.0E-150
sp|A5IY09|SYI_MYCAP Isoleucine--tRNA ligase OS=Mycoplasma agalactiae (strain PG2) GN=ileS PE=3 SV=1 2 947 3.0E-150
sp|B5Y235|SYI_KLEP3 Isoleucine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=ileS PE=3 SV=1 2 950 5.0E-150
sp|B7N7Q0|SYI_ECOLU Isoleucine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ileS PE=3 SV=1 2 950 5.0E-150
sp|A7ZVX4|SYI_ECOHS Isoleucine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=ileS PE=3 SV=1 2 950 6.0E-150
sp|B8GQR1|SYI_THISH Isoleucine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=ileS PE=3 SV=1 2 950 6.0E-150
sp|Q8FLB7|SYI_ECOL6 Isoleucine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ileS PE=3 SV=1 2 950 6.0E-150
sp|B7MNN1|SYI_ECO81 Isoleucine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=ileS PE=3 SV=1 2 950 6.0E-150
sp|B1LFV6|SYI_ECOSM Isoleucine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ileS PE=3 SV=1 2 950 7.0E-150
sp|B7NHD0|SYI_ECO7I Isoleucine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ileS PE=3 SV=1 2 950 7.0E-150
sp|Q8ZRZ0|SYI_SALTY Isoleucine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ileS PE=3 SV=1 2 950 7.0E-150
sp|Q0TLW5|SYI_ECOL5 Isoleucine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ileS PE=3 SV=1 2 950 8.0E-150
sp|A8ALT6|SYI_CITK8 Isoleucine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ileS PE=3 SV=1 2 950 8.0E-150
sp|Q83MH2|SYI_SHIFL Isoleucine--tRNA ligase OS=Shigella flexneri GN=ileS PE=3 SV=1 2 950 8.0E-150
sp|B5RF43|SYI_SALG2 Isoleucine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ileS PE=3 SV=1 2 950 9.0E-150
sp|B5R1N6|SYI_SALEP Isoleucine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=ileS PE=3 SV=1 2 950 9.0E-150
sp|Q57TL5|SYI_SALCH Isoleucine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=ileS PE=3 SV=2 2 950 9.0E-150
sp|Q8Z9N2|SYI_SALTI Isoleucine--tRNA ligase OS=Salmonella typhi GN=ileS PE=3 SV=1 2 950 1.0E-149
sp|B0UV12|SYI_HISS2 Isoleucine--tRNA ligase OS=Histophilus somni (strain 2336) GN=ileS PE=3 SV=1 2 955 2.0E-149
sp|Q820M6|SYI_NITEU Isoleucine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ileS PE=3 SV=1 2 941 2.0E-149
sp|B5YYB8|SYI_ECO5E Isoleucine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ileS PE=3 SV=1 2 950 2.0E-149
sp|Q8XA49|SYI_ECO57 Isoleucine--tRNA ligase OS=Escherichia coli O157:H7 GN=ileS PE=3 SV=1 2 950 2.0E-149
sp|A7I1S7|SYI_CAMHC Isoleucine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=ileS PE=3 SV=1 2 945 3.0E-149
sp|B7UI71|SYI_ECO27 Isoleucine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ileS PE=3 SV=1 2 950 3.0E-149
sp|B2GB86|SYI_LACF3 Isoleucine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=ileS PE=3 SV=1 3 948 5.0E-149
sp|Q0AAD1|SYI_ALKEH Isoleucine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ileS PE=3 SV=1 2 955 5.0E-149
sp|B1JKZ8|SYI_YERPY Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ileS PE=3 SV=1 2 950 9.0E-149
sp|Q66ES4|SYI_YERPS Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ileS PE=3 SV=1 2 950 9.0E-149
sp|A4TQF3|SYI_YERPP Isoleucine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=ileS PE=3 SV=1 2 950 9.0E-149
sp|Q1CMV1|SYI_YERPN Isoleucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ileS PE=3 SV=1 2 950 9.0E-149
sp|A9R008|SYI_YERPG Isoleucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ileS PE=3 SV=1 2 950 9.0E-149
sp|Q8ZIM0|SYI_YERPE Isoleucine--tRNA ligase OS=Yersinia pestis GN=ileS PE=3 SV=1 2 950 9.0E-149
sp|B2K3M6|SYI_YERPB Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ileS PE=3 SV=1 2 950 9.0E-149
sp|Q1C0J3|SYI_YERPA Isoleucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ileS PE=3 SV=1 2 950 9.0E-149
sp|Q21HK3|SYI_SACD2 Isoleucine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ileS PE=3 SV=1 2 955 1.0E-148
sp|Q836V1|SYI_ENTFA Isoleucine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ileS PE=3 SV=1 3 948 1.0E-148
sp|A1JJE1|SYI_YERE8 Isoleucine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ileS PE=3 SV=1 2 950 1.0E-148
sp|Q1I4S5|SYI_PSEE4 Isoleucine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=ileS PE=3 SV=1 2 955 1.0E-148
sp|Q0HS82|SYI_SHESR Isoleucine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=ileS PE=3 SV=1 2 950 1.0E-148
sp|A9NBM5|SYI_COXBR Isoleucine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ileS PE=3 SV=1 2 941 2.0E-148
sp|Q0I1V8|SYI_HAES1 Isoleucine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=ileS PE=3 SV=1 2 955 2.0E-148
sp|A3MYB6|SYI_ACTP2 Isoleucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ileS PE=3 SV=1 2 955 2.0E-148
sp|C0R112|SYI_BRAHW Isoleucine--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=ileS PE=3 SV=1 2 946 2.0E-148
sp|Q0HFY9|SYI_SHESM Isoleucine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=ileS PE=3 SV=1 2 950 3.0E-148
sp|B5BLL0|SYI_SALPK Isoleucine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=ileS PE=3 SV=1 2 950 3.0E-148
sp|Q5PDL9|SYI_SALPA Isoleucine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ileS PE=3 SV=1 2 950 3.0E-148
sp|Q38XM0|SYI_LACSS Isoleucine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ileS PE=3 SV=1 3 945 3.0E-148
sp|Q83EC9|SYI_COXBU Isoleucine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ileS PE=3 SV=1 2 941 3.0E-148
sp|A8FSI2|SYI_SHESH Isoleucine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=ileS PE=3 SV=1 2 955 3.0E-148
sp|B1I721|SYI_STRPI Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=ileS PE=3 SV=1 3 962 4.0E-148
sp|Q486U0|SYI_COLP3 Isoleucine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ileS PE=3 SV=1 2 955 6.0E-148
sp|B0KM84|SYI_PSEPG Isoleucine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=ileS PE=3 SV=1 2 955 7.0E-148
sp|A3QBX2|SYI_SHELP Isoleucine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ileS PE=3 SV=1 2 955 8.0E-148
sp|Q98PQ2|SYI_MYCPU Isoleucine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ileS PE=3 SV=1 37 945 9.0E-148
sp|Q03L88|SYI_STRTD Isoleucine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ileS PE=3 SV=1 3 948 9.0E-148
sp|Q6FG02|SYI_ACIAD Isoleucine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ileS PE=3 SV=1 2 941 9.0E-148
sp|C1CFN0|SYI_STRZJ Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=ileS PE=3 SV=1 3 962 1.0E-147
sp|B3GZN4|SYI_ACTP7 Isoleucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ileS PE=3 SV=1 2 955 1.0E-147
sp|Q15R04|SYI_PSEA6 Isoleucine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=ileS PE=3 SV=1 2 951 1.0E-147
sp|B6J1S2|SYI_COXB2 Isoleucine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=ileS PE=3 SV=1 2 941 1.0E-147
sp|Q47BK5|SYI_DECAR Isoleucine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=ileS PE=3 SV=1 2 955 2.0E-147
sp|Q88V89|SYI_LACPL Isoleucine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ileS PE=3 SV=1 3 948 2.0E-147
sp|B6J9J5|SYI_COXB1 Isoleucine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=ileS PE=3 SV=1 2 941 2.0E-147
sp|C1CSS4|SYI_STRZT Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=ileS PE=3 SV=1 3 962 2.0E-147
sp|B1JF83|SYI_PSEPW Isoleucine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=ileS PE=3 SV=1 2 955 2.0E-147
sp|A7FMD7|SYI_YERP3 Isoleucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ileS PE=3 SV=1 2 950 3.0E-147
sp|A0KZZ1|SYI_SHESA Isoleucine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=ileS PE=3 SV=1 2 950 3.0E-147
sp|A4SIX5|SYI_AERS4 Isoleucine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=ileS PE=3 SV=1 2 955 3.0E-147
sp|Q5M4X2|SYI_STRT2 Isoleucine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ileS PE=3 SV=1 3 948 4.0E-147
sp|Q5M0C5|SYI_STRT1 Isoleucine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ileS PE=3 SV=1 3 948 4.0E-147
sp|B1KIT5|SYI_SHEWM Isoleucine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ileS PE=3 SV=1 2 955 4.0E-147
sp|Q03QI3|SYI_LACBA Isoleucine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ileS PE=3 SV=1 3 948 4.0E-147
sp|P0CB61|SYI_STRPN Isoleucine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ileS PE=3 SV=1 3 962 6.0E-147
sp|C6DF04|SYI_PECCP Isoleucine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ileS PE=3 SV=1 2 950 6.0E-147
sp|A9KEI8|SYI_COXBN Isoleucine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ileS PE=3 SV=1 2 941 6.0E-147
sp|A7GX26|SYI_CAMC5 Isoleucine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=ileS PE=3 SV=1 2 945 6.0E-147
sp|Q8DNW4|SYI_STRR6 Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ileS PE=3 SV=1 3 962 6.0E-147
sp|Q04JB0|SYI_STRP2 Isoleucine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ileS PE=3 SV=1 3 962 6.0E-147
sp|B5E709|SYI_STRP4 Isoleucine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=ileS PE=3 SV=1 3 962 1.0E-146
sp|Q7VQL0|SYI_BLOFL Isoleucine--tRNA ligase OS=Blochmannia floridanus GN=ileS PE=3 SV=1 2 942 1.0E-146
sp|A3CLP4|SYI_STRSV Isoleucine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=ileS PE=3 SV=1 3 948 1.0E-146
sp|Q7NBG0|SYI_MYCGA Isoleucine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=ileS PE=3 SV=2 36 945 1.0E-146
sp|Q605M7|SYI_METCA Isoleucine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ileS PE=3 SV=1 2 950 1.0E-146
sp|Q5X6G6|SYI_LEGPA Isoleucine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=ileS PE=3 SV=1 2 950 1.0E-146
sp|Q8DVD3|SYI_STRMU Isoleucine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ileS PE=3 SV=1 3 948 1.0E-146
sp|A5IFX5|SYI_LEGPC Isoleucine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=ileS PE=3 SV=1 2 950 2.0E-146
sp|Q6D0C3|SYI_PECAS Isoleucine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ileS PE=3 SV=1 2 950 2.0E-146
sp|B8ZM55|SYI_STRPJ Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=ileS PE=3 SV=1 3 962 2.0E-146
sp|Q7MAL0|SYI_WOLSU Isoleucine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ileS PE=3 SV=1 2 945 2.0E-146
sp|A5VY52|SYI_PSEP1 Isoleucine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ileS PE=3 SV=1 2 955 2.0E-146
sp|A8G9L4|SYI_SERP5 Isoleucine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=ileS PE=3 SV=1 2 941 3.0E-146
sp|B2IRR4|SYI_STRPS Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=ileS PE=3 SV=1 3 962 3.0E-146
sp|Q1LSS9|SYI_BAUCH Isoleucine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=ileS PE=3 SV=1 2 942 4.0E-146
sp|Q2NVY6|SYI_SODGM Isoleucine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=ileS PE=3 SV=1 2 945 5.0E-146
sp|Q3IEA2|SYI_PSEHT Isoleucine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ileS PE=3 SV=1 2 950 7.0E-146
sp|Q7VGX8|SYI_HELHP Isoleucine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ileS PE=3 SV=1 2 950 7.0E-146
sp|Q88Q92|SYI_PSEPK Isoleucine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=ileS PE=3 SV=1 2 955 9.0E-146
sp|C1C8P8|SYI_STRP7 Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=ileS PE=3 SV=1 3 962 1.0E-145
sp|Q2L2K5|SYI_BORA1 Isoleucine--tRNA ligase OS=Bordetella avium (strain 197N) GN=ileS PE=3 SV=1 2 941 1.0E-145
sp|Q5ZWZ6|SYI_LEGPH Isoleucine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ileS PE=3 SV=1 2 950 1.0E-145
sp|C1CLZ8|SYI_STRZP Isoleucine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=ileS PE=3 SV=1 3 962 1.0E-145
sp|Q0VSE1|SYI_ALCBS Isoleucine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ileS PE=3 SV=1 2 950 2.0E-145
sp|Q5WXX1|SYI_LEGPL Isoleucine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=ileS PE=3 SV=1 2 950 2.0E-145
sp|Q89AU9|SYI_BUCBP Isoleucine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ileS PE=3 SV=1 2 941 3.0E-145
sp|Q30SH2|SYI_SULDN Isoleucine--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=ileS PE=3 SV=1 2 945 3.0E-145
sp|Q493S3|SYI_BLOPB Isoleucine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=ileS PE=3 SV=1 2 945 4.0E-145
sp|Q7N8X2|SYI_PHOLL Isoleucine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ileS PE=3 SV=1 2 950 7.0E-145
sp|A8AW24|SYI_STRGC Isoleucine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=ileS PE=3 SV=1 3 962 8.0E-145
sp|A4XQV5|SYI_PSEMY Isoleucine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=ileS PE=3 SV=1 2 955 8.0E-145
sp|Q03EY9|SYI_PEDPA Isoleucine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ileS PE=3 SV=1 3 948 1.0E-144
sp|C5BQX2|SYI_TERTT Isoleucine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ileS PE=3 SV=1 2 950 2.0E-144
sp|Q4K5U4|SYI_PSEF5 Isoleucine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ileS PE=3 SV=1 2 950 3.0E-144
sp|Q2S9T9|SYI_HAHCH Isoleucine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=ileS PE=3 SV=1 2 950 4.0E-144
sp|Q889E4|SYI_PSESM Isoleucine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ileS PE=3 SV=1 2 955 6.0E-144
sp|A0KG39|SYI_AERHH Isoleucine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ileS PE=3 SV=1 2 955 6.0E-144
sp|B2VGR6|SYI_ERWT9 Isoleucine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ileS PE=3 SV=1 2 950 9.0E-144
sp|Q4ZYJ4|SYI_PSEU2 Isoleucine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ileS PE=3 SV=1 2 955 1.0E-143
sp|Q48SL8|SYI_STRPM Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ileS PE=3 SV=1 3 885 2.0E-143
sp|B7V0A3|SYI_PSEA8 Isoleucine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=ileS PE=3 SV=1 2 950 2.0E-143
sp|Q4AAS1|SYI_MYCHJ Isoleucine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=ileS PE=3 SV=2 1 945 2.0E-143
sp|Q9HVM4|SYI_PSEAE Isoleucine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ileS PE=3 SV=1 2 950 2.0E-143
sp|A6VBU7|SYI_PSEA7 Isoleucine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=ileS PE=3 SV=1 2 950 3.0E-143
sp|Q5FRI6|SYI_GLUOX Isoleucine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=ileS PE=3 SV=1 2 945 5.0E-143
sp|Q02GB7|SYI_PSEAB Isoleucine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ileS PE=3 SV=1 2 950 5.0E-143
sp|Q4FPA9|SYI_PELUB Isoleucine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=ileS PE=3 SV=1 1 928 6.0E-143
sp|Q8E177|SYI_STRA5 Isoleucine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ileS PE=3 SV=1 3 928 6.0E-143
sp|Q3K2N4|SYI_STRA1 Isoleucine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ileS PE=3 SV=1 3 928 6.0E-143
sp|C1DPH5|SYI_AZOVD Isoleucine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ileS PE=3 SV=1 2 955 1.0E-142
sp|A9IRC2|SYI_BORPD Isoleucine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ileS PE=3 SV=1 2 955 1.0E-142
sp|Q8E6N1|SYI_STRA3 Isoleucine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ileS PE=3 SV=1 3 928 1.0E-142
sp|Q99YW3|SYI_STRP1 Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=ileS PE=3 SV=1 3 885 2.0E-142
sp|A8Z6P6|SYI_CAMC1 Isoleucine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=ileS PE=3 SV=1 2 945 4.0E-142
sp|Q602B7|SYI_MYCH2 Isoleucine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=ileS PE=3 SV=1 1 947 4.0E-142
sp|P0DG43|SYI_STRPQ Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ileS PE=3 SV=1 3 885 5.0E-142
sp|P0DG42|SYI_STRP3 Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ileS PE=3 SV=1 3 885 5.0E-142
sp|A1K4R7|SYI_AZOSB Isoleucine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=ileS PE=3 SV=1 2 943 2.0E-141
sp|Q6MT28|SYI_MYCMS Isoleucine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=ileS PE=3 SV=1 44 952 2.0E-141
sp|Q5NQQ7|SYI_ZYMMO Isoleucine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ileS PE=3 SV=1 2 945 2.0E-141
sp|Q6KHN7|SYI_MYCMO Isoleucine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ileS PE=3 SV=1 2 751 2.0E-141
sp|B9KD44|SYI_CAMLR Isoleucine--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=ileS PE=3 SV=1 2 949 3.0E-141
sp|Q039Q9|SYI_LACC3 Isoleucine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=ileS PE=3 SV=1 3 946 3.0E-141
sp|Q9JVY4|SYI_NEIMA Isoleucine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ileS PE=3 SV=1 33 950 3.0E-141
sp|A4VI60|SYI_PSEU5 Isoleucine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=ileS PE=3 SV=1 2 950 3.0E-141
sp|Q8FX81|SYI_BRUSU Isoleucine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=ileS PE=3 SV=1 2 949 4.0E-141
sp|A7MIM3|SYI_CROS8 Isoleucine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ileS PE=3 SV=1 2 950 4.0E-141
sp|P57249|SYI_BUCAI Isoleucine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ileS PE=3 SV=1 2 941 4.0E-141
sp|Q4FUS5|SYI_PSYA2 Isoleucine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ileS PE=3 SV=1 2 950 5.0E-141
sp|B5Z943|SYI_HELPG Isoleucine--tRNA ligase OS=Helicobacter pylori (strain G27) GN=ileS PE=3 SV=1 2 948 6.0E-141
sp|Q8UHJ6|SYI_AGRFC Isoleucine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ileS PE=3 SV=1 2 936 7.0E-141
sp|B8D754|SYI_BUCAT Isoleucine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=ileS PE=3 SV=1 2 941 8.0E-141
sp|B8D8V0|SYI_BUCA5 Isoleucine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=ileS PE=3 SV=1 2 941 8.0E-141
sp|B2FTJ0|SYI_STRMK Isoleucine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=ileS PE=3 SV=1 2 950 9.0E-141
sp|Q1R0B5|SYI_CHRSD Isoleucine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ileS PE=3 SV=1 2 941 1.0E-140
sp|Q9ZJJ1|SYI_HELPJ Isoleucine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ileS PE=3 SV=1 2 948 1.0E-140
sp|P18330|SYI1_PSEFL Isoleucine--tRNA ligase 1 OS=Pseudomonas fluorescens GN=ileS1 PE=3 SV=2 2 955 1.0E-140
sp|P0C123|SYI_BRUAB Isoleucine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=ileS PE=3 SV=1 2 949 2.0E-140
sp|P0C124|SYI_BRUA2 Isoleucine--tRNA ligase OS=Brucella abortus (strain 2308) GN=ileS PE=3 SV=1 2 949 2.0E-140
sp|Q17ZG3|SYI_HELAH Isoleucine--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=ileS PE=3 SV=1 2 949 2.0E-140
sp|B4SP18|SYI_STRM5 Isoleucine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=ileS PE=3 SV=1 2 950 2.0E-140
sp|A1TYY9|SYI_MARHV Isoleucine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ileS PE=3 SV=1 2 946 3.0E-140
sp|Q4A8Y0|SYI_MYCH7 Isoleucine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=ileS PE=3 SV=2 1 945 3.0E-140
sp|Q48NK6|SYI_PSE14 Isoleucine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ileS PE=3 SV=1 2 955 4.0E-140
sp|Q5XB14|SYI_STRP6 Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ileS PE=3 SV=1 3 885 4.0E-140
sp|B3WDZ1|SYI_LACCB Isoleucine--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=ileS PE=3 SV=1 3 946 6.0E-140
sp|Q8P068|SYI_STRP8 Isoleucine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ileS PE=3 SV=1 3 885 6.0E-140
sp|Q6F175|SYI_MESFL Isoleucine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ileS PE=3 SV=1 1 946 9.0E-140
sp|Q8YB57|SYI_BRUME Isoleucine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ileS PE=3 SV=1 2 949 1.0E-139
sp|B2UVG2|SYI_HELPS Isoleucine--tRNA ligase OS=Helicobacter pylori (strain Shi470) GN=ileS PE=3 SV=1 2 948 1.0E-139
sp|B0RY28|SYI_XANCB Isoleucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ileS PE=3 SV=1 2 950 1.0E-139
sp|Q3K6L5|SYI_PSEPF Isoleucine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ileS PE=3 SV=1 2 955 2.0E-139
sp|Q1LJB8|SYI_CUPMC Isoleucine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ileS PE=3 SV=1 42 941 2.0E-139
sp|Q8PBG6|SYI_XANCP Isoleucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ileS PE=3 SV=1 2 950 4.0E-139
sp|Q4US40|SYI_XANC8 Isoleucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ileS PE=3 SV=1 2 950 4.0E-139
sp|Q5P221|SYI_AROAE Isoleucine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=ileS PE=3 SV=1 2 941 5.0E-139
sp|P56456|SYI_HELPY Isoleucine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ileS PE=3 SV=1 2 948 6.0E-139
sp|A9M1J7|SYI_NEIM0 Isoleucine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ileS PE=3 SV=1 33 950 6.0E-139
sp|C3KDX4|SYI_PSEFS Isoleucine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=ileS PE=3 SV=1 2 950 6.0E-139
sp|C1DCX2|SYI_LARHH Isoleucine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=ileS PE=3 SV=1 33 955 8.0E-139
sp|Q4A5K5|SYI_MYCS5 Isoleucine--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=ileS PE=3 SV=2 2 946 2.0E-138
sp|Q1CRK7|SYI_HELPH Isoleucine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=ileS PE=3 SV=1 2 948 3.0E-138
sp|Q8D2R0|SYI_WIGBR Isoleucine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=ileS PE=3 SV=1 2 950 4.0E-138
sp|A6SW71|SYI_JANMA Isoleucine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=ileS PE=3 SV=1 32 951 6.0E-138
sp|A1KS62|SYI_NEIMF Isoleucine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ileS PE=3 SV=1 33 950 1.0E-137
sp|B6JNR5|SYI_HELP2 Isoleucine--tRNA ligase OS=Helicobacter pylori (strain P12) GN=ileS PE=3 SV=1 2 948 5.0E-137
sp|Q7VXK3|SYI_BORPE Isoleucine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ileS PE=3 SV=1 2 941 1.0E-136
sp|Q3BW42|SYI_XANC5 Isoleucine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ileS PE=3 SV=1 2 950 1.0E-136
sp|B4RPY6|SYI_NEIG2 Isoleucine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=ileS PE=3 SV=1 2 950 1.0E-136
sp|Q8K9Z2|SYI_BUCAP Isoleucine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ileS PE=3 SV=1 2 941 2.0E-136
sp|B1YVA4|SYI_BURA4 Isoleucine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=ileS PE=3 SV=1 28 955 2.0E-136
sp|Q0K7A0|SYI_CUPNH Isoleucine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ileS PE=3 SV=1 32 941 2.0E-136
sp|Q7W8Z2|SYI_BORPA Isoleucine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ileS PE=3 SV=1 2 941 4.0E-136
sp|Q7WKD5|SYI_BORBR Isoleucine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ileS PE=3 SV=1 2 941 4.0E-136
sp|Q7NS57|SYI_CHRVO Isoleucine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ileS PE=3 SV=1 35 950 4.0E-136
sp|Q5FAF5|SYI_NEIG1 Isoleucine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ileS PE=3 SV=1 33 950 5.0E-136
sp|Q9JXY7|SYI_NEIMB Isoleucine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ileS PE=3 SV=1 33 950 9.0E-136
sp|Q0BCK8|SYI_BURCM Isoleucine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ileS PE=3 SV=1 28 955 1.0E-135
sp|Q8EUN9|SYI_MYCPE Isoleucine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=ileS PE=3 SV=1 2 945 1.0E-135
sp|A9AGN6|SYI_BURM1 Isoleucine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ileS PE=3 SV=1 28 955 2.0E-135
sp|Q39DM8|SYI_BURL3 Isoleucine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ileS PE=3 SV=1 28 955 2.0E-135
sp|Q63WI3|SYI1_BURPS Isoleucine--tRNA ligase 1 OS=Burkholderia pseudomallei (strain K96243) GN=ileS1 PE=3 SV=1 10 955 2.0E-135
sp|A4G3E6|SYI_HERAR Isoleucine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=ileS PE=3 SV=1 32 955 2.0E-135
sp|P41257|SYI_CAMJE Isoleucine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ileS PE=3 SV=2 2 949 3.0E-135
sp|Q62HL4|SYI1_BURMA Isoleucine--tRNA ligase 1 OS=Burkholderia mallei (strain ATCC 23344) GN=ileS1 PE=3 SV=1 10 955 3.0E-135
sp|Q2T0H3|SYI_BURTA Isoleucine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ileS PE=3 SV=1 10 955 6.0E-135
sp|Q46XM7|SYI_CUPPJ Isoleucine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ileS PE=3 SV=2 32 941 8.0E-135
sp|A4JH32|SYI_BURVG Isoleucine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ileS PE=3 SV=1 28 955 1.0E-134
sp|A0K9T5|SYI_BURCH Isoleucine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=ileS PE=3 SV=1 28 955 1.0E-134
sp|Q1BUA1|SYI_BURCA Isoleucine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=ileS PE=3 SV=1 28 955 1.0E-134
sp|Q6G4S5|SYI_BARHE Isoleucine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ileS PE=3 SV=1 2 949 1.0E-134
sp|B1JXC3|SYI_BURCC Isoleucine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=ileS PE=3 SV=1 28 955 2.0E-134
sp|B2JDY9|SYI_BURP8 Isoleucine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ileS PE=3 SV=1 32 955 3.0E-134
sp|B3R6E8|SYI_CUPTR Isoleucine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ileS PE=3 SV=1 32 941 4.0E-134
sp|Q9PQ79|SYI_UREPA Isoleucine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ileS PE=3 SV=1 2 781 6.0E-134
sp|Q983N4|SYI_RHILO Isoleucine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=ileS PE=3 SV=2 2 945 6.0E-134
sp|B4E8Z7|SYI_BURCJ Isoleucine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ileS PE=3 SV=1 28 955 9.0E-134
sp|Q5H2E1|SYI_XANOR Isoleucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ileS PE=3 SV=1 2 950 1.0E-133
sp|Q2P5B0|SYI_XANOM Isoleucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ileS PE=3 SV=1 2 950 1.0E-133
sp|A5EWT0|SYI_DICNV Isoleucine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=ileS PE=3 SV=1 2 945 2.0E-133
sp|Q5LNR7|SYI_RUEPO Isoleucine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ileS PE=3 SV=1 2 941 3.0E-133
sp|B2UAQ4|SYI_RALPJ Isoleucine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=ileS PE=3 SV=1 32 955 4.0E-133
sp|Q9AAA5|SYI_CAUCR Isoleucine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ileS PE=3 SV=1 2 945 7.0E-133
sp|Q8PN19|SYI_XANAC Isoleucine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ileS PE=3 SV=1 2 950 1.0E-132
sp|Q13UW2|SYI_BURXL Isoleucine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=ileS PE=3 SV=1 32 955 1.0E-132
sp|Q6G0K6|SYI_BARQU Isoleucine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=ileS PE=3 SV=1 2 949 1.0E-131
sp|B2T6I7|SYI_BURPP Isoleucine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ileS PE=3 SV=1 32 955 2.0E-131
sp|Q5HU41|SYI_CAMJR Isoleucine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=ileS PE=3 SV=1 2 949 4.0E-131
sp|Q87BL5|SYI_XYLFT Isoleucine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ileS PE=3 SV=1 2 941 1.0E-129
sp|B2I6V2|SYI_XYLF2 Isoleucine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=ileS PE=3 SV=1 2 941 1.0E-129
sp|B0U3Q9|SYI_XYLFM Isoleucine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=ileS PE=3 SV=1 2 941 1.0E-129
sp|Q9PAS7|SYI_XYLFA Isoleucine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=ileS PE=3 SV=1 2 950 9.0E-129
sp|Q63KP6|SYI2_BURPS Isoleucine--tRNA ligase 2 OS=Burkholderia pseudomallei (strain K96243) GN=ileS2 PE=3 SV=1 2 952 1.0E-127
sp|P47587|SYI_MYCGE Isoleucine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ileS PE=3 SV=1 3 944 2.0E-127
sp|Q3SPJ6|SYI_NITWN Isoleucine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ileS PE=3 SV=1 2 936 4.0E-127
sp|Q62CD5|SYI2_BURMA Isoleucine--tRNA ligase 2 OS=Burkholderia mallei (strain ATCC 23344) GN=ileS2 PE=3 SV=1 2 952 3.0E-126
sp|Q057X9|SYI_BUCCC Isoleucine--tRNA ligase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=ileS PE=3 SV=1 3 781 6.0E-125
sp|Q89DF8|SYI_BRADU Isoleucine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ileS PE=3 SV=1 2 936 6.0E-122
sp|Q6N1M8|SYI_RHOPA Isoleucine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ileS PE=3 SV=1 2 951 2.0E-121
sp|P75258|SYI_MYCPN Isoleucine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ileS PE=3 SV=1 28 785 3.0E-112
sp|O29622|SYI_ARCFU Isoleucine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ileS PE=3 SV=1 12 782 4.0E-107
sp|Q8TWY2|SYI_METKA Isoleucine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ileS PE=3 SV=1 44 780 5.0E-105
sp|P46214|SYI_PYRFU Isoleucine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ileS PE=3 SV=2 28 785 6.0E-102
sp|P46207|SYI_AQUPY Isoleucine--tRNA ligase (Fragment) OS=Aquifex pyrophilus GN=ileS PE=3 SV=1 89 604 3.0E-100
sp|Q5JJ31|SYI_THEKO Isoleucine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=ileS PE=3 SV=1 43 785 4.0E-100
sp|Q9V072|SYI_PYRAB Isoleucine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ileS PE=3 SV=1 32 785 1.0E-99
sp|O58792|SYI_PYRHO Isoleucine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ileS PE=3 SV=1 28 785 3.0E-99
sp|A0B7P3|SYI_METTP Isoleucine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=ileS PE=3 SV=1 35 782 9.0E-97
sp|A3CSI6|SYI_METMJ Isoleucine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ileS PE=3 SV=1 32 782 1.0E-96
sp|Q12ZD1|SYI_METBU Isoleucine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=ileS PE=3 SV=1 28 782 4.0E-96
sp|P26499|SYI_METTM Isoleucine--tRNA ligase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=ileS PE=1 SV=3 28 782 2.0E-95
sp|O27428|SYI_METTH Isoleucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ileS PE=3 SV=3 28 782 6.0E-95
sp|A7IAM2|SYI_METB6 Isoleucine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=ileS PE=3 SV=1 35 811 8.0E-94
sp|Q18GW3|SYI_HALWD Isoleucine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ileS PE=3 SV=1 43 891 8.0E-94
sp|Q2FPJ4|SYI_METHJ Isoleucine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ileS PE=3 SV=1 34 785 3.0E-93
sp|Q465G4|SYI_METBF Isoleucine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=ileS PE=3 SV=1 34 782 3.0E-92
sp|Q8TN62|SYI_METAC Isoleucine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ileS PE=3 SV=1 28 782 2.0E-90
sp|Q8PSV9|SYI_METMA Isoleucine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ileS PE=3 SV=1 28 782 5.0E-90
sp|P46215|SYI_SULAC Isoleucine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ileS PE=3 SV=2 28 780 2.0E-88
sp|A2SPV6|SYI_METLZ Isoleucine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=ileS PE=3 SV=1 35 782 2.0E-87
sp|Q3ITY7|SYI_NATPD Isoleucine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ileS PE=3 SV=1 42 780 2.0E-87
sp|Q58357|SYI_METJA Isoleucine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ileS PE=3 SV=1 28 782 4.0E-84
sp|C3MVH6|SYI_SULIM Isoleucine--tRNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=ileS PE=3 SV=1 28 780 8.0E-84
sp|C3N5S5|SYI_SULIA Isoleucine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=ileS PE=3 SV=1 28 780 8.0E-84
sp|Q9YF67|SYI_AERPE Isoleucine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=ileS PE=3 SV=1 28 780 1.0E-83
sp|Q975H9|SYI_SULTO Isoleucine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ileS PE=3 SV=2 28 780 9.0E-83
sp|Q0W720|SYI_METAR Isoleucine--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=ileS PE=3 SV=1 28 782 3.0E-81
sp|Q9HN97|SYI_HALSA Isoleucine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=ileS PE=3 SV=1 42 782 1.0E-76
sp|Q9UXB1|SYI_SULSO Isoleucine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ileS PE=3 SV=1 66 780 2.0E-76
sp|A6UVK2|SYI_META3 Isoleucine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=ileS PE=3 SV=1 28 782 3.0E-76
sp|Q81R75|SYI2_BACAN Isoleucine--tRNA ligase 2 OS=Bacillus anthracis GN=ileS2 PE=3 SV=1 36 779 4.0E-75
sp|Q81E30|SYI2_BACCR Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ileS2 PE=3 SV=2 36 779 2.0E-73
sp|P56690|SYI_THET8 Isoleucine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ileS PE=1 SV=2 21 782 6.0E-73
sp|Q63BZ8|SYI2_BACCZ Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ZK / E33L) GN=ileS2 PE=3 SV=1 36 779 6.0E-73
sp|P41368|SYI2_STAAU Isoleucine--tRNA ligase OS=Staphylococcus aureus GN=ileS PE=3 SV=1 41 779 7.0E-73
sp|Q9Z972|SYI_CHLPN Isoleucine--tRNA ligase OS=Chlamydia pneumoniae GN=ileS PE=3 SV=1 36 785 9.0E-73
sp|Q739A1|SYI2_BACC1 Isoleucine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ileS2 PE=3 SV=1 36 779 2.0E-72
sp|O84022|SYI_CHLTR Isoleucine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=ileS PE=3 SV=1 43 782 2.0E-72
sp|Q94425|SYIM_CIOIN Probable isoleucine--tRNA ligase, mitochondrial (Fragment) OS=Ciona intestinalis PE=3 SV=1 309 687 3.0E-72
sp|Q72JR6|SYI_THET2 Isoleucine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ileS PE=3 SV=2 21 782 4.0E-72
sp|Q6HJF2|SYI2_BACHK Isoleucine--tRNA ligase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ileS2 PE=3 SV=1 36 779 6.0E-72
sp|B0B9C6|SYI_CHLT2 Isoleucine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ileS PE=3 SV=1 43 782 6.0E-72
sp|B0BB05|SYI_CHLTB Isoleucine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=ileS PE=3 SV=1 43 782 7.0E-72
sp|A0RDG3|SYI_BACAH Isoleucine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=ileS PE=3 SV=1 36 779 9.0E-72
sp|Q822L8|SYI_CHLCV Isoleucine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=ileS PE=3 SV=1 41 802 2.0E-71
sp|Q3KN03|SYI_CHLTA Isoleucine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=ileS PE=3 SV=1 43 782 3.0E-71
sp|Q5L5L0|SYI_CHLAB Isoleucine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=ileS PE=3 SV=1 44 782 4.0E-71
sp|Q5UZ84|SYI_HALMA Isoleucine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ileS PE=3 SV=1 42 780 1.0E-70
sp|Q5YYW9|SYI_NOCFA Isoleucine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=ileS PE=3 SV=1 44 780 3.0E-69
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup940
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3001 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6099
Ophiocordyceps camponoti-floridani Ophcf2|02683
Ophiocordyceps camponoti-rufipedis Ophun1|5890
Ophiocordyceps kimflemingae Ophio5|6931
Ophiocordyceps subramaniannii Hirsu2|6816

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|3001
MWKSTLKLPRSLIPVRQHPSDWPRLVLESSGVYQRQRPTSKESFSIQDGPPYANGPLHAGHALNKILKDIIVRFQ
IQSGKIVSYRPGWDCHGLPIELKALEPNGPGRLSPDKIRSRASKLAEREMKAQMEQFKSFAVAADWENVWATTQP
SYELRQLVLLKTMVASGLVHRKHKPIYWSPVSGSALAESELEYNDHHISQAVFIRYPIEASSCGALAELANYKDK
LFAVIWTTTPWTLPANKAIAVHQDLEYSVLRVGQDAYLVASSCIPIISRHLPEFTVEVASIPGSHLLGLEYHNKM
REEGAPAQKIIHADFVSSDSGTGMVHLAPGHGQDDYEVCSGLGMDAFSPIDDKSCYTKEAYPKKPELLTSAPSVI
DGGAMAVLSILGQDVLAEHAHQHRYPYDWRTKTPVIVRATAQWFADVSSIKEASIKALEKVRFIPEAGKSRLESF
IKSRSEWCISRQRPWGVPIPALYDSKGNAIMTPQIMQHIITVMKGRSIDAWFSDEEFDTAWIPPNFRGQFYRRGT
DTLDVWFDSGCSWLETNEVADVYLEGSDQHRGWFQSSLLTYVAWQKAAGKKDSDIVAPFKTLITHGFVLDGKGKK
MSKSAGNVINPEDVMNGLLMTRTKYKEGRLIERPGMDNLGPDALRLWVASRDYASDVTLGHASLQPVQQNLIKYR
NVLRMLVGSLQEPSGEMPFTKLDQIALIQLSDAMEKVVQAFNNYELHKASQRINIWVGRDLSAFYLEALKDRLYC
GDGNSALHYIFVGFLRMLAPITPLLVEEIWSHRPLWMKEDSYWQHPADGVYLDPVESKRHLFTIDPSQLRSESRL
LIAIHYVVKQLLEQGRSKGMFGSSLQCRVVVEVDDDDILSILKVYQDEMADMYVVSGVDINTGMEEDALWAFSSP
LTVHGVAEPKGVVHVVPPRGSKCQRCWRYVGESGEDICARCADVVKKQQEAEDAAACAAEEKV*
Coding >OphauG2|3001
ATGTGGAAGTCAACCCTGAAGCTTCCCAGATCGCTGATTCCAGTACGCCAACATCCCTCCGACTGGCCGCGACTT
GTGCTTGAAAGCTCTGGGGTCTACCAGCGCCAGCGCCCTACTTCAAAAGAATCATTTTCCATCCAAGATGGCCCC
CCATACGCCAATGGCCCGTTACATGCTGGCCATGCGCTCAATAAAATTCTCAAAGACATAATCGTCCGCTTTCAG
ATACAGAGCGGCAAAATCGTCAGCTACAGGCCAGGCTGGGATTGCCATGGCTTGCCCATTGAGCTCAAGGCTCTC
GAGCCAAACGGCCCTGGCAGGTTGAGCCCTGATAAAATAAGAAGTCGCGCATCAAAACTGGCTGAGCGAGAAATG
AAGGCTCAAATGGAACAATTCAAATCTTTTGCTGTCGCAGCAGACTGGGAGAATGTGTGGGCCACAACACAGCCC
AGCTACGAGCTTAGACAATTAGTCCTGCTCAAGACAATGGTCGCCTCTGGACTTGTCCATCGAAAGCACAAACCC
ATTTATTGGTCCCCTGTGTCGGGCTCGGCGTTGGCCGAGTCGGAACTTGAATACAACGACCATCATATATCTCAG
GCTGTCTTCATCAGGTACCCAATTGAGGCTTCAAGCTGCGGCGCCCTGGCAGAACTGGCAAACTACAAAGACAAG
CTATTTGCTGTCATCTGGACCACGACTCCCTGGACCTTGCCCGCTAACAAAGCAATTGCTGTTCACCAAGACCTC
GAGTATTCGGTTTTGCGCGTCGGACAGGATGCCTACCTTGTGGCCTCGAGCTGTATTCCCATTATTAGTCGTCAT
CTACCCGAGTTCACCGTCGAGGTGGCTTCTATTCCGGGCTCTCATCTTCTAGGCCTCGAATATCATAACAAGATG
CGTGAAGAGGGTGCCCCAGCGCAGAAAATCATTCATGCCGATTTTGTTTCAAGCGACTCTGGTACGGGCATGGTT
CATTTAGCTCCTGGACACGGTCAGGACGACTACGAAGTGTGTTCTGGCCTGGGTATGGATGCATTTTCTCCTATA
GATGACAAGTCTTGCTATACAAAAGAAGCTTATCCCAAAAAGCCTGAGCTCTTGACATCGGCTCCTTCTGTCATC
GACGGGGGCGCCATGGCCGTGTTGAGTATCCTAGGGCAGGATGTCCTAGCAGAACATGCGCATCAACATAGATAC
CCCTATGACTGGCGCACCAAAACACCCGTCATTGTGAGGGCCACTGCGCAGTGGTTTGCTGACGTCTCAAGCATC
AAAGAAGCATCAATCAAGGCCCTGGAGAAGGTCCGTTTTATTCCAGAGGCCGGAAAGTCGCGTCTGGAGAGCTTC
ATCAAGAGTAGGAGCGAGTGGTGCATCTCTCGCCAACGGCCCTGGGGCGTCCCTATTCCCGCTCTCTACGATAGC
AAAGGCAATGCCATTATGACCCCACAAATCATGCAACACATCATCACTGTCATGAAAGGACGCAGTATCGATGCT
TGGTTCTCCGACGAGGAATTTGATACGGCGTGGATCCCGCCAAATTTTCGAGGACAATTTTATCGCCGTGGCACT
GATACATTGGATGTATGGTTTGACAGCGGATGCAGCTGGTTGGAAACAAATGAGGTGGCAGATGTCTATCTTGAG
GGATCAGATCAACATCGCGGCTGGTTCCAGTCGAGTCTTCTGACGTATGTGGCCTGGCAGAAGGCCGCTGGAAAG
AAAGACAGCGACATTGTTGCTCCATTCAAGACTCTGATTACTCATGGATTCGTCCTGGATGGTAAAGGCAAAAAG
ATGTCCAAGTCGGCAGGAAACGTCATCAACCCCGAAGACGTCATGAACGGCTTGCTCATGACTAGAACCAAATAC
AAGGAAGGGAGGCTAATAGAGCGGCCTGGGATGGACAATTTGGGACCCGATGCATTGCGACTATGGGTGGCCAGT
CGCGACTATGCTTCGGATGTTACGCTTGGCCACGCCTCCCTTCAGCCAGTTCAGCAGAATCTTATCAAGTATCGC
AATGTTTTGAGAATGCTTGTCGGCTCGCTTCAAGAGCCCAGCGGCGAGATGCCTTTCACAAAGCTTGACCAGATT
GCCCTGATACAGCTCAGCGATGCCATGGAGAAGGTTGTGCAAGCGTTTAATAATTACGAGCTTCACAAAGCAAGC
CAACGCATCAACATCTGGGTTGGACGAGACTTGTCTGCCTTTTACCTGGAGGCACTCAAGGATCGGCTCTACTGC
GGGGATGGCAACAGTGCTTTGCACTATATATTTGTGGGATTTCTGCGCATGTTGGCTCCCATCACTCCACTATTA
GTCGAGGAAATATGGTCGCACCGACCGCTGTGGATGAAGGAGGACAGTTATTGGCAGCATCCGGCCGACGGGGTT
TACCTCGACCCTGTAGAAAGCAAACGCCATCTCTTCACGATTGATCCAAGTCAGCTTCGAAGTGAAAGCCGGTTA
TTGATTGCCATTCATTACGTCGTCAAGCAACTTCTTGAGCAAGGACGAAGCAAAGGCATGTTTGGATCTTCGCTG
CAATGCCGCGTAGTAGTTGAGGTGGATGACGACGACATACTGTCAATTCTCAAAGTGTATCAAGATGAAATGGCC
GACATGTATGTCGTCTCGGGAGTCGACATCAACACAGGGATGGAAGAAGACGCTCTGTGGGCATTTTCAAGTCCC
TTGACCGTTCACGGCGTGGCTGAGCCCAAGGGAGTTGTACACGTGGTGCCGCCAAGAGGCTCCAAGTGCCAGAGG
TGTTGGCGTTATGTGGGAGAGAGCGGCGAGGATATCTGCGCACGATGCGCAGACGTTGTCAAGAAGCAACAAGAG
GCCGAGGATGCGGCGGCATGTGCAGCCGAGGAAAAGGTCTAG
Transcript >OphauG2|3001
ATGTGGAAGTCAACCCTGAAGCTTCCCAGATCGCTGATTCCAGTACGCCAACATCCCTCCGACTGGCCGCGACTT
GTGCTTGAAAGCTCTGGGGTCTACCAGCGCCAGCGCCCTACTTCAAAAGAATCATTTTCCATCCAAGATGGCCCC
CCATACGCCAATGGCCCGTTACATGCTGGCCATGCGCTCAATAAAATTCTCAAAGACATAATCGTCCGCTTTCAG
ATACAGAGCGGCAAAATCGTCAGCTACAGGCCAGGCTGGGATTGCCATGGCTTGCCCATTGAGCTCAAGGCTCTC
GAGCCAAACGGCCCTGGCAGGTTGAGCCCTGATAAAATAAGAAGTCGCGCATCAAAACTGGCTGAGCGAGAAATG
AAGGCTCAAATGGAACAATTCAAATCTTTTGCTGTCGCAGCAGACTGGGAGAATGTGTGGGCCACAACACAGCCC
AGCTACGAGCTTAGACAATTAGTCCTGCTCAAGACAATGGTCGCCTCTGGACTTGTCCATCGAAAGCACAAACCC
ATTTATTGGTCCCCTGTGTCGGGCTCGGCGTTGGCCGAGTCGGAACTTGAATACAACGACCATCATATATCTCAG
GCTGTCTTCATCAGGTACCCAATTGAGGCTTCAAGCTGCGGCGCCCTGGCAGAACTGGCAAACTACAAAGACAAG
CTATTTGCTGTCATCTGGACCACGACTCCCTGGACCTTGCCCGCTAACAAAGCAATTGCTGTTCACCAAGACCTC
GAGTATTCGGTTTTGCGCGTCGGACAGGATGCCTACCTTGTGGCCTCGAGCTGTATTCCCATTATTAGTCGTCAT
CTACCCGAGTTCACCGTCGAGGTGGCTTCTATTCCGGGCTCTCATCTTCTAGGCCTCGAATATCATAACAAGATG
CGTGAAGAGGGTGCCCCAGCGCAGAAAATCATTCATGCCGATTTTGTTTCAAGCGACTCTGGTACGGGCATGGTT
CATTTAGCTCCTGGACACGGTCAGGACGACTACGAAGTGTGTTCTGGCCTGGGTATGGATGCATTTTCTCCTATA
GATGACAAGTCTTGCTATACAAAAGAAGCTTATCCCAAAAAGCCTGAGCTCTTGACATCGGCTCCTTCTGTCATC
GACGGGGGCGCCATGGCCGTGTTGAGTATCCTAGGGCAGGATGTCCTAGCAGAACATGCGCATCAACATAGATAC
CCCTATGACTGGCGCACCAAAACACCCGTCATTGTGAGGGCCACTGCGCAGTGGTTTGCTGACGTCTCAAGCATC
AAAGAAGCATCAATCAAGGCCCTGGAGAAGGTCCGTTTTATTCCAGAGGCCGGAAAGTCGCGTCTGGAGAGCTTC
ATCAAGAGTAGGAGCGAGTGGTGCATCTCTCGCCAACGGCCCTGGGGCGTCCCTATTCCCGCTCTCTACGATAGC
AAAGGCAATGCCATTATGACCCCACAAATCATGCAACACATCATCACTGTCATGAAAGGACGCAGTATCGATGCT
TGGTTCTCCGACGAGGAATTTGATACGGCGTGGATCCCGCCAAATTTTCGAGGACAATTTTATCGCCGTGGCACT
GATACATTGGATGTATGGTTTGACAGCGGATGCAGCTGGTTGGAAACAAATGAGGTGGCAGATGTCTATCTTGAG
GGATCAGATCAACATCGCGGCTGGTTCCAGTCGAGTCTTCTGACGTATGTGGCCTGGCAGAAGGCCGCTGGAAAG
AAAGACAGCGACATTGTTGCTCCATTCAAGACTCTGATTACTCATGGATTCGTCCTGGATGGTAAAGGCAAAAAG
ATGTCCAAGTCGGCAGGAAACGTCATCAACCCCGAAGACGTCATGAACGGCTTGCTCATGACTAGAACCAAATAC
AAGGAAGGGAGGCTAATAGAGCGGCCTGGGATGGACAATTTGGGACCCGATGCATTGCGACTATGGGTGGCCAGT
CGCGACTATGCTTCGGATGTTACGCTTGGCCACGCCTCCCTTCAGCCAGTTCAGCAGAATCTTATCAAGTATCGC
AATGTTTTGAGAATGCTTGTCGGCTCGCTTCAAGAGCCCAGCGGCGAGATGCCTTTCACAAAGCTTGACCAGATT
GCCCTGATACAGCTCAGCGATGCCATGGAGAAGGTTGTGCAAGCGTTTAATAATTACGAGCTTCACAAAGCAAGC
CAACGCATCAACATCTGGGTTGGACGAGACTTGTCTGCCTTTTACCTGGAGGCACTCAAGGATCGGCTCTACTGC
GGGGATGGCAACAGTGCTTTGCACTATATATTTGTGGGATTTCTGCGCATGTTGGCTCCCATCACTCCACTATTA
GTCGAGGAAATATGGTCGCACCGACCGCTGTGGATGAAGGAGGACAGTTATTGGCAGCATCCGGCCGACGGGGTT
TACCTCGACCCTGTAGAAAGCAAACGCCATCTCTTCACGATTGATCCAAGTCAGCTTCGAAGTGAAAGCCGGTTA
TTGATTGCCATTCATTACGTCGTCAAGCAACTTCTTGAGCAAGGACGAAGCAAAGGCATGTTTGGATCTTCGCTG
CAATGCCGCGTAGTAGTTGAGGTGGATGACGACGACATACTGTCAATTCTCAAAGTGTATCAAGATGAAATGGCC
GACATGTATGTCGTCTCGGGAGTCGACATCAACACAGGGATGGAAGAAGACGCTCTGTGGGCATTTTCAAGTCCC
TTGACCGTTCACGGCGTGGCTGAGCCCAAGGGAGTTGTACACGTGGTGCCGCCAAGAGGCTCCAAGTGCCAGAGG
TGTTGGCGTTATGTGGGAGAGAGCGGCGAGGATATCTGCGCACGATGCGCAGACGTTGTCAAGAAGCAACAAGAG
GCCGAGGATGCGGCGGCATGTGCAGCCGAGGAAAAGGTCTAG
Gene >OphauG2|3001
ATGTGGAAGTCAACCCTGAAGCTTCCCAGATCGCTGATTCCGTACTCCTGCCGAATATCCTACCCGTCATATTAG
CCTGCTGACTTGCAGTCGTAAACAGAGTACGCCAACATCCCTCCGACTGGCCGCGACTTGTGCTTGAAAGCTCTG
GGGTCTACCAGCGCCAGCGCCCTACTTCAAAAGAATCATTTTCCATCCAAGATGGCCCCCCATACGCCAATGGCC
CGTTACATGCTGGCCATGCGCTCAATAAAATTCTCAAAGACATAATCGTCCGCTTTCAGATACAGAGCGGCAAAA
TCGTCAGCTACAGGCCAGGCTGGGATTGCCATGGCTTGCCCATTGAGCTCAAGGCTCTCGAGCCAAACGGCCCTG
GCAGGTTGAGCCCTGATAAAATAAGAAGTCGCGCATCAAAACTGGCTGAGCGAGAAATGAAGGCTCAAATGGAAC
AATTCAAATCTTTTGCTGTCGCAGCAGACTGGGAGAATGTGTGGGCCACAACACAGCCCAGCTACGAGCTTAGAC
AATTAGTCCTGCTCAAGACAATGGTCGCCTCTGGACTTGTCCATCGAAAGCACAAACCCATTTATTGGTCCCCTG
TGTCGGGCTCGGCGTTGGCCGAGTCGGAACTTGAATACAACGACCATCATATATCTCAGGCTGTCTTCATCAGGT
ACCCAATTGAGGCTTCAAGCTGCGGCGCCCTGGCAGAACTGGCAAACTACAAAGACAAGCTATTTGCTGTCATCT
GGACCACGACTCCCTGGACCTTGCCCGCTAACAAAGCAATTGCTGTTCACCAAGACCTCGAGTATTCGGTTTTGC
GCGTCGGACAGGATGCCTACCTTGTGGCCTCGAGCTGTATTCCCATTATTAGTCGTCATCTACCCGAGTTCACCG
TCGAGGTGGCTTCTATTCCGGGCTCTCATCTTCTAGGCCTCGAATATCATAACAAGATGCGTGAAGAGGGTGCCC
CAGCGCAGAAAATCATTCATGCCGATTTTGTTTCAAGCGACTCTGGTACGGGCATGGTTCATTTAGCTCCTGGAC
ACGGTCAGGACGACTACGAAGTGTGTTCTGGCCTGGGTATGGATGCATTTTCTCCTATAGATGACAAGTCTTGCT
ATACAAAAGAAGCTTATCCCAAAAAGCCTGAGCTCTTGACATCGGCTCCTTCTGTCATCGACGGGGGCGCCATGG
CCGTGTTGAGTATCCTAGGGCAGGATGTCCTAGCAGAACATGCGCATCAACATAGATACCCCTATGACTGGCGCA
CCAAAACACCCGTCATTGTGAGGGCCACTGCGCAGTGGTTTGCTGACGTCTCAAGCATCAAAGAAGCATCAATCA
AGGCCCTGGAGAAGGTCCGTTTTATTCCAGAGGCCGGAAAGTCGCGTCTGGAGAGCTTCATCAAGAGTAGGAGCG
AGTGGTGCATCTCTCGCCAACGGCCCTGGGGCGTCCCTATTCCCGCTCTCTACGATAGCAAAGGCAATGCCATTA
TGACCCCACAAATCATGCAACACATCATCACTGTCATGAAAGGACGCAGTATCGATGCTTGGTTCTCCGACGAGG
AATTTGATACGGCGTGGATCCCGCCAAATTTTCGAGGACAATTTTATCGCCGTGGCACTGATACATTGGATGTAT
GGTTTGACAGCGGATGCAGCTGGTTGGAAACAAATGAGGTGGCAGATGTCTATCTTGAGGGATCAGATCAACATC
GCGGCTGGTTCCAGTCGAGTCTTCTGACGTATGTGGCCTGGCAGAAGGCCGCTGGAAAGAAAGACAGCGACATTG
TTGCTCCATTCAAGACTCTGATTACTCATGGATTCGTCCTGGATGGTAAAGGCAAAAAGATGTCCAAGTCGGCAG
GAAACGTCATCAACCCCGAAGACGTCATGAACGGCTTGCTCATGACTAGAACCAAATACAAGGAAGGGAGGCTAA
TAGAGCGGCCTGGGATGGACAATTTGGGACCCGATGCATTGCGACTATGGGTGGCCAGTCGCGACTATGCTTCGG
ATGTTACGCTTGGCCACGCCTCCCTTCAGCCAGTTCAGCAGAATCTTATCAAGTATCGCAATGTTTTGAGAATGC
TTGTCGGCTCGCTTCAAGAGCCCAGCGGCGAGATGCCTTTCACAAAGCTTGACCAGATTGCCCTGATACAGCTCA
GCGATGCCATGGAGAAGGTTGTGCAAGCGTTTAATAATTACGAGCTTCACAAAGCAAGCCAACGCATCAACATCT
GGGTTGGACGAGACTTGTCTGCCTTTTACCTGGAGGCACTCAAGGATCGGCTCTACTGCGGGGATGGCAACAGTG
CTTTGCACTATATATTTGTGGGATTTCTGCGCATGTTGGCTCCCATCACTCCACTATTAGTCGAGGAAATATGGT
CGCACCGACCGCTGTGGATGAAGGAGGACAGGTTTGTGTTGAGTCCTGGCAGGGCGGTGGAAGAGGATGACGCTG
ATAATATATGCGGGCAGTTATTGGCAGCATCCGGCCGACGGGGTTTACCTCGACCCTGTAGAAAGCAAACGCCAT
CTCTTCACGATTGATCCAAGTCAGCTTCGAAGTGAAAGCCGGTTATTGATTGCCATTCATTACGTCGTCAAGCAA
CTTCTTGAGCAAGGACGAAGCAAAGGCATGTTTGGATCTTCGCTGCAATGCCGCGTAGTAGTTGAGGTGGATGAC
GACGACATACTGTCAATTCTCAAAGTGTATCAAGATGAAATGGCCGACATGTATGTCGTCTCGGGAGTCGACATC
AACACAGGGATGGAAGAAGACGCTCTGTGGGCATTTTCAAGTCCCTTGACCGTTCACGGCGTGGCTGAGCCCAAG
GGAGTTGTACACGTGGTGCCGCCAAGAGGCTCCAAGTGCCAGAGGTGTTGGCGTTATGTGGGAGAGAGCGGCGAG
GATATCTGCGCACGATGCGCAGACGTTGTCAAGAAGCAACAAGAGGCCGAGGATGCGGCGGCATGTGCAGCCGAG
GAAAAGGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail