Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|30
Gene name
LocationContig_1:74656..76669
Strand+
Gene length (bp)2013
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16114 Citrate_bind ATP citrate lyase citrate-binding 3.1E-88 323 499
PF08442 ATP-grasp_2 ATP-grasp domain 8.6E-08 97 253

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13907|ACL2_SCHPO Probable ATP-citrate synthase subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.16 PE=1 SV=1 26 505 0.0E+00
sp|Q32PF2|ACLY_BOVIN ATP-citrate synthase OS=Bos taurus GN=ACLY PE=2 SV=1 26 499 2.0E-136
sp|Q2TCH3|ACLY_SHEEP ATP-citrate synthase OS=Ovis aries GN=ACLY PE=2 SV=1 26 499 3.0E-136
sp|P53396|ACLY_HUMAN ATP-citrate synthase OS=Homo sapiens GN=ACLY PE=1 SV=3 26 499 6.0E-135
sp|Q91V92|ACLY_MOUSE ATP-citrate synthase OS=Mus musculus GN=Acly PE=1 SV=1 26 499 1.0E-134
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13907|ACL2_SCHPO Probable ATP-citrate synthase subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.16 PE=1 SV=1 26 505 0.0E+00
sp|Q32PF2|ACLY_BOVIN ATP-citrate synthase OS=Bos taurus GN=ACLY PE=2 SV=1 26 499 2.0E-136
sp|Q2TCH3|ACLY_SHEEP ATP-citrate synthase OS=Ovis aries GN=ACLY PE=2 SV=1 26 499 3.0E-136
sp|P53396|ACLY_HUMAN ATP-citrate synthase OS=Homo sapiens GN=ACLY PE=1 SV=3 26 499 6.0E-135
sp|Q91V92|ACLY_MOUSE ATP-citrate synthase OS=Mus musculus GN=Acly PE=1 SV=1 26 499 1.0E-134
sp|P16638|ACLY_RAT ATP-citrate synthase OS=Rattus norvegicus GN=Acly PE=1 SV=1 26 498 8.0E-134
sp|P53585|ACLY_CAEEL Probable ATP-citrate synthase OS=Caenorhabditis elegans GN=D1005.1 PE=3 SV=1 26 499 2.0E-121
sp|Q2QNG7|ACLA3_ORYSJ ATP-citrate synthase alpha chain protein 3 OS=Oryza sativa subsp. japonica GN=ACLA-3 PE=2 SV=1 26 499 2.0E-104
sp|Q2QZ86|ACLA2_ORYSJ ATP-citrate synthase alpha chain protein 2 OS=Oryza sativa subsp. japonica GN=ACLA-2 PE=2 SV=2 26 499 7.0E-104
sp|O22718|ACLA2_ARATH ATP-citrate synthase alpha chain protein 2 OS=Arabidopsis thaliana GN=ACLA-2 PE=2 SV=1 26 499 3.0E-101
sp|O80526|ACLA3_ARATH ATP-citrate synthase alpha chain protein 3 OS=Arabidopsis thaliana GN=ACLA-3 PE=2 SV=1 26 499 3.0E-101
sp|Q9SGY2|ACLA1_ARATH ATP-citrate synthase alpha chain protein 1 OS=Arabidopsis thaliana GN=ACLA-1 PE=1 SV=1 26 499 3.0E-99
sp|Q53JY8|ACLA1_ORYSJ ATP-citrate synthase subunit alpha chain protein 1 OS=Oryza sativa subsp. japonica GN=ACLA-1 PE=3 SV=2 26 499 4.0E-90
sp|B1YIL7|SUCC_EXIS2 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=sucC PE=3 SV=1 110 472 2.0E-09
sp|Q4L5U8|SUCC_STAHJ Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=sucC PE=3 SV=1 110 467 1.0E-06
sp|Q57663|SUCC_METJA Succinyl-CoA ligase [ADP-forming] subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=sucC PE=3 SV=1 100 280 1.0E-06
sp|Q49X32|SUCC_STAS1 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sucC PE=3 SV=1 110 474 5.0E-06
sp|B9DPG0|SUCC_STACT Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus carnosus (strain TM300) GN=sucC PE=3 SV=1 110 472 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|30
MAVRTVRTNNSIVSLGAPVPLSLPAMSAKAILEADGKAILNYHLTRAPVIKPSPLPRPTKHNAAPRLASLHFPED
ANVTDVLNQAEVTYPWLLQAGAKFVAKPDQLIKRRGKSGLLALNKSWPEAKAWIAERAGKEQKVEHTTGVLRQFL
VEPFVPHPQDTEYYININSVRDGDWILFTHQGGVDVGDVDAKAEKLLIPVDLSQYPSNDEIAAALLKKVPKGVHN
VLVDFITRLYAVYVDCQFTYLEINPLVVIPNEAKTSAEVHFLDLAAKLDQTADFECGVKWAIARSPAALGLTNVA
PVNGEKVNIDAGPPMDFPAPFGRELTKEEAYIADLDAKTGASLKLTVLNPNGRIWTLVAGGGASVVYADAIASAG
FADDLANYGEYSGAPTESQTYHYARTVLDLMLRAPMSDKGKVLFIGGGIANFTNVASTFKGVIRALRDFATQLNE
HKVQIWVRRAGPNYQEGLKNMKAATQELGLKAKIFGPEMHVSGIVPLALVAGKWEESKAEEFRG*
Coding >OphauG2|30
ATGGCTGTCCGCACTGTCCGCACTAACAATAGCATTGTATCCCTCGGAGCTCCTGTCCCCCTCTCCCTGCCCGCC
ATGTCCGCAAAAGCCATCCTCGAGGCCGATGGCAAGGCCATCCTCAATTACCACCTGACGCGAGCTCCCGTCATC
AAACCGAGTCCCCTGCCTCGGCCCACCAAGCACAACGCTGCTCCCAGGCTGGCTTCGTTGCATTTCCCCGAGGAC
GCCAATGTCACCGACGTGCTCAACCAGGCCGAGGTGACGTATCCCTGGCTGCTGCAGGCTGGCGCAAAGTTTGTG
GCCAAGCCCGACCAGCTCATTAAGCGACGCGGCAAAAGCGGCCTGCTGGCCCTCAACAAGTCATGGCCAGAAGCC
AAGGCTTGGATTGCAGAGCGAGCTGGCAAGGAGCAAAAGGTCGAGCACACGACTGGCGTTCTGAGACAGTTTCTG
GTTGAGCCCTTTGTCCCCCATCCCCAGGACACCGAGTACTACATCAACATCAACTCTGTCCGTGATGGCGACTGG
ATCCTCTTTACGCACCAAGGCGGTGTCGACGTTGGCGACGTGGATGCCAAGGCCGAGAAGCTTCTCATTCCTGTA
GACCTGTCGCAATACCCTTCCAACGACGAGATTGCGGCTGCGCTTCTCAAAAAGGTGCCCAAGGGGGTGCACAAT
GTGCTCGTCGACTTCATCACCCGCCTCTACGCCGTCTACGTCGACTGCCAGTTTACCTATCTCGAAATCAACCCT
CTGGTGGTGATACCAAATGAGGCCAAGACTTCTGCCGAGGTTCATTTTCTCGACCTGGCTGCCAAGCTGGATCAG
ACTGCCGACTTTGAGTGCGGCGTCAAGTGGGCCATTGCTCGCTCTCCCGCCGCGCTTGGCCTGACCAACGTGGCG
CCGGTAAACGGCGAAAAAGTCAACATTGATGCCGGCCCTCCCATGGACTTTCCTGCGCCCTTTGGCCGCGAGCTC
ACCAAGGAGGAGGCCTACATTGCAGATCTCGACGCCAAGACTGGCGCGTCGCTCAAGCTCACGGTGCTCAACCCC
AACGGTCGCATCTGGACCTTGGTTGCTGGTGGCGGTGCATCAGTCGTGTATGCCGACGCCATTGCCTCTGCAGGC
TTTGCCGACGACCTGGCCAACTATGGCGAATACTCGGGAGCACCGACTGAGTCGCAGACGTATCACTATGCCCGC
ACTGTGCTCGATTTGATGCTCCGTGCCCCAATGTCAGACAAGGGCAAGGTGCTTTTTATTGGCGGCGGCATTGCC
AACTTTACAAATGTGGCCAGCACCTTCAAGGGCGTCATTCGAGCACTGCGTGACTTTGCCACACAGCTGAATGAG
CACAAGGTCCAAATCTGGGTCCGGCGCGCCGGGCCCAACTACCAAGAGGGCCTCAAGAACATGAAGGCGGCCACT
CAGGAGCTCGGGCTCAAGGCCAAGATTTTCGGGCCCGAGATGCACGTGTCTGGCATCGTGCCCCTTGCTCTGGTG
GCTGGGAAGTGGGAAGAGAGCAAGGCTGAAGAGTTTAGAGGGTAG
Transcript >OphauG2|30
ATGGCTGTCCGCACTGTCCGCACTAACAATAGCATTGTATCCCTCGGAGCTCCTGTCCCCCTCTCCCTGCCCGCC
ATGTCCGCAAAAGCCATCCTCGAGGCCGATGGCAAGGCCATCCTCAATTACCACCTGACGCGAGCTCCCGTCATC
AAACCGAGTCCCCTGCCTCGGCCCACCAAGCACAACGCTGCTCCCAGGCTGGCTTCGTTGCATTTCCCCGAGGAC
GCCAATGTCACCGACGTGCTCAACCAGGCCGAGGTGACGTATCCCTGGCTGCTGCAGGCTGGCGCAAAGTTTGTG
GCCAAGCCCGACCAGCTCATTAAGCGACGCGGCAAAAGCGGCCTGCTGGCCCTCAACAAGTCATGGCCAGAAGCC
AAGGCTTGGATTGCAGAGCGAGCTGGCAAGGAGCAAAAGGTCGAGCACACGACTGGCGTTCTGAGACAGTTTCTG
GTTGAGCCCTTTGTCCCCCATCCCCAGGACACCGAGTACTACATCAACATCAACTCTGTCCGTGATGGCGACTGG
ATCCTCTTTACGCACCAAGGCGGTGTCGACGTTGGCGACGTGGATGCCAAGGCCGAGAAGCTTCTCATTCCTGTA
GACCTGTCGCAATACCCTTCCAACGACGAGATTGCGGCTGCGCTTCTCAAAAAGGTGCCCAAGGGGGTGCACAAT
GTGCTCGTCGACTTCATCACCCGCCTCTACGCCGTCTACGTCGACTGCCAGTTTACCTATCTCGAAATCAACCCT
CTGGTGGTGATACCAAATGAGGCCAAGACTTCTGCCGAGGTTCATTTTCTCGACCTGGCTGCCAAGCTGGATCAG
ACTGCCGACTTTGAGTGCGGCGTCAAGTGGGCCATTGCTCGCTCTCCCGCCGCGCTTGGCCTGACCAACGTGGCG
CCGGTAAACGGCGAAAAAGTCAACATTGATGCCGGCCCTCCCATGGACTTTCCTGCGCCCTTTGGCCGCGAGCTC
ACCAAGGAGGAGGCCTACATTGCAGATCTCGACGCCAAGACTGGCGCGTCGCTCAAGCTCACGGTGCTCAACCCC
AACGGTCGCATCTGGACCTTGGTTGCTGGTGGCGGTGCATCAGTCGTGTATGCCGACGCCATTGCCTCTGCAGGC
TTTGCCGACGACCTGGCCAACTATGGCGAATACTCGGGAGCACCGACTGAGTCGCAGACGTATCACTATGCCCGC
ACTGTGCTCGATTTGATGCTCCGTGCCCCAATGTCAGACAAGGGCAAGGTGCTTTTTATTGGCGGCGGCATTGCC
AACTTTACAAATGTGGCCAGCACCTTCAAGGGCGTCATTCGAGCACTGCGTGACTTTGCCACACAGCTGAATGAG
CACAAGGTCCAAATCTGGGTCCGGCGCGCCGGGCCCAACTACCAAGAGGGCCTCAAGAACATGAAGGCGGCCACT
CAGGAGCTCGGGCTCAAGGCCAAGATTTTCGGGCCCGAGATGCACGTGTCTGGCATCGTGCCCCTTGCTCTGGTG
GCTGGGAAGTGGGAAGAGAGCAAGGCTGAAGAGTTTAGAGGGTAG
Gene >OphauG2|30
ATGGCTGTCCGCACTGTCCGCACTGTCCGGATACCGCCGTTCCCTGGATCCCATCCAGCTCAATTGATGGGACCC
AGCTAAACCACTCCCAAAGCCCGTCAGGAGCTTTGCGCCTCGAGCCAGGTCCATCTTGCACTCTCTCTCTGCCCG
AGCCCGGATTTTTGACGCTGACGGAACGCTGACTCTCTCACCACGGCCGCCTTGGTCCTTGTCCAAAAAACTCTC
AGATAACCCGCTCGACGCCTCATCCTTAGCCAGCTGCATCTTTTCGCCTGCGCCTTGTCTTGCAACGCCAACAAT
AGAACAATAGGTGAGGGCCCTTTTAATGCTGCTCTGCGCCGCTTGGCATCCACTGACACGGCTGCATTGCCTAGC
ATTGTATCCCTCGGAGCTCCTGTCCCCCTCTCCCTGCCCGCCATGTCCGCAAAAGCCATCCTCGAGGCCGATGGC
AAGGCCATCCTCAATTACCACCTGACGCGAGCTCCCGTCATCAAACCGAGTCCCCTGCCTCGGCCCACCAAGCAC
AACGCTGCTCCCAGGCTGGCTTCGTTGCATTTCCCCGAGGACGCCAATGTCACCGACGTGCTCAACCAGGCCGAG
GTGACGTATCCCTGGCTGCTGCAGGCTGGCGCAAAGTTTGTGGCCAAGCCCGACCAGCTCATTAAGCGACGCGGC
AAAAGCGGCCTGCTGGCCCTCAACAAGTCATGGCCAGAAGCCAAGGCTTGGATTGCAGAGCGAGCTGGCAAGGAG
CAAAAGGTCGAGCACACGACTGGCGTTCTGAGACAGTTTCTGGTTGAGCCCTTTGTCCCCCATCCCCAGGACACC
GAGTACTACATCAACATCAACTCTGTCCGTGATGTAAGTGCCCACTCGCTTTGCCCATGGCTGTGCAACAAGACG
CATTGAGGCTTGTCGGATCCATGTGCAAGGAGACGAGGCGAACATGGGCTCCAAGACACAGGCTGACGCAACACA
AATACGCAGGGCGACTGGATCCTCTTTACGCACCAAGGCGGTGTCGACGTTGGCGACGTGGATGCCAAGGCCGAG
AAGCTTCTCATTCCTGTAGACCTGTCGCAATACCCTTCCAACGACGAGATTGCGGCTGCGCTTCTCAAAAAGGTG
CCCAAGGGGGTGCACAATGTGCTCGTCGACTTCATCACCCGCCTCTACGCCGTCTACGTCGACTGCCAGTTTACC
TATCTCGAAATCAACCCTCTGGTGGTGATACCAAATGAGGCCAAGACTTCTGCCGAGGTTCATTTTCTCGACCTG
GCTGCCAAGCTGGATCAGACTGCCGACTTTGAGTGCGGCGTCAAGTGGGCCATTGCTCGCTCTCCCGCCGCGCTT
GGCCTGACCAACGTGGCGCCGGTAAACGGCGAAAAAGTCAACATTGATGCCGGCCCTCCCATGGACTTTCCTGCG
CCCTTTGGCCGCGAGCTCACCAAGGAGGAGGCCTACATTGCAGATCTCGACGCCAAGACTGGCGCGTCGCTCAAG
CTCACGGTGCTCAACCCCAACGGTCGCATCTGGACCTTGGTTGCTGGTGGCGGTGCATCAGTCGTGTATGCCGAC
GCCATTGCCTCTGCAGGCTTTGCCGACGACCTGGCCAACTATGGCGAATACTCGGGAGCACCGACTGAGTCGCAG
ACGTATCACTATGCCCGCACTGTGCTCGATTTGATGCTCCGTGCCCCAATGTCAGACAAGGGCAAGGTGCTTTTT
ATTGGCGGCGGCATTGCCAACTTTACAAATGTGGCCAGCACCTTCAAGGGCGTCATTCGAGCACTGCGTGACTTT
GCCACACAGCTGAATGAGCACAAGGTCCAAATCTGGGTCCGGCGCGCCGGGCCCAACTACCAAGAGGGCCTCAAG
AACATGAAGGCGGCCACTCAGGAGCTCGGGCTCAAGGCCAAGATTTTCGGGCCCGAGATGCACGTGTCTGGCATC
GTGCCCCTTGCTCTGGTGGCTGGGAAGTGGGAAGAGAGCAAGGCTGAAGAGTTTAGAGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail