Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2977
Gene name
LocationContig_219:35..3665
Strand+
Gene length (bp)3630
Transcript length (bp)3582
Coding sequence length (bp)3582
Protein length (aa) 1194

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 54 920 1.0E-53
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 710 1025 7.0E-22
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 502 1028 9.0E-17
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 523 1030 2.0E-15
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 689 1025 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 54 920 1.0E-53
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 710 1025 7.0E-22
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 502 1028 9.0E-17
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 523 1030 2.0E-15
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 689 1025 2.0E-13
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 502 855 1.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 635 1028 3.0E-12
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 728 1027 1.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 687 837 2.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 562 1027 3.0E-08
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 689 853 3.0E-08
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 688 842 8.0E-07
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 729 920 1.0E-06
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 578 830 3.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 717 920 4.0E-06
sp|Q6GMD2|WDR61_XENLA WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 710 834 4.0E-06
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 570 829 5.0E-06
sp|Q4V7A0|WDR61_RAT WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 709 834 5.0E-06
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 570 829 6.0E-06
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 677 854 6.0E-06
sp|Q9ERF3|WDR61_MOUSE WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 709 834 8.0E-06
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 747 1020 9.0E-06
sp|Q5ZJH5|WDR61_CHICK WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 710 834 9.0E-06
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 709 855 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6035
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1553
Ophiocordyceps australis 1348a (Ghana) OphauG2|2977 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1376
Ophiocordyceps subramaniannii Hirsu2|2246
Ophiocordyceps subramaniannii Hirsu2|6027

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2977
MAQLVEALPGLAKDVEDVLDSNHSIVDQDFRNQFEKLYRGPLQKSDSKSKNIVIVIDALDECDSQTEISDLLRLL
SKPLYYKQNGRDTPVKYFLTGRHDGHSLSRLQRLHPDQIENCHNPDLEELTAETIGDDIKRFLKFRLQEVPALWD
GDKDPWANAKNVDTLGQLVTKACPLFEFAATACRLIEDDNLLGDAKSRLYDILATKCNGDLDHLYWTVLNTRLRS
SDDKIAPRRQKMVEEQFRRVIGSVMSLADPVSVSCLAHLLGETKAMVVNELRHFKSVLDVPSNDDRVIKIFHESF
RDFFHGSAQGEFGLDERKTHEHLALRCRELLCGKDGKKDALRENFCELESPGAYRREIPEKVLCESISPEVQYAC
RFWVHHLKNSDDKIKDNDAWYQLLHKHFLHWLEALGLLGRISESVQFVKELQTLVESNAGTQIEAFLKDAERFIC
KFCPIVNEAPLQLYISGLTFAPTESIIRRTFDTHRPMWITRLPEVGAHWSPCLQTLPFSVYDNACLVSSSEGLLA
VGHEDGDIEMWDPIAGIRLKFFDPSSGSEPLSEISSLALSQTGKLACATETSIIVWDITQDNHLNSLTLNRDEGK
VISMAFRNGQHLLFATIEGKIASWDIGNGPPRHLEICCNLYKPILSNDGRWIAGFDELGVTLIATEAKPGCPPKK
LTLDAGRKTSIMRFSPGGQYLAIAYVFHEHQNLGNVEVWDTVSTQRLQSLDTGLVWSLAVSADNRRLATAKKEIV
IWDWENGSRLQVFDPGDEIIDSLAFSPKGSWLASSDEVNGVQIWDVAASYYGTPGTPGTHRSCIKSIAMSMDGER
LISGSLSRYELWEKSGSICFPQPLHGGESWYERREGLYEPIVAISANGEVVAMNCESGVEIQNLKSGICLPLLPR
NWTRLYSMTLSANGERLLLGLKSGPRVGGCGLVWSTSKGKRLKEIDIPLRRWVDVGAAMSLDGQKVALVFDSTVH
VENLCTNQLLKRKLLRVTQAAFSEDGQRVAALSQTCDGGIWEVETGVCLRRFRNEDPNGVLCLDIKLIDVDFAVA
GDLPEQLPLMDCLIDGGYVSHDCEWLMKGTNRVLRLPRDSWPTCTAVSKAHIAVGLVSGHAFVVGMAWDNIPGDC
KAVDVSQDSDEDSEEDSDEESDEDSEGDSDEESDEDSDENSDQESDEDSDENSDEESDEESDEDSEEI*
Coding >OphauG2|2977
ATGGCTCAGCTAGTGGAAGCATTGCCAGGCCTTGCCAAGGACGTTGAGGATGTCTTGGACTCTAACCATTCGATT
GTTGATCAAGATTTCAGGAACCAATTCGAGAAGCTTTATCGAGGACCTTTGCAAAAATCCGATTCTAAATCCAAA
AACATAGTAATTGTCATTGACGCTCTGGACGAATGTGATTCACAGACGGAAATCTCGGATCTGCTAAGACTGCTC
TCGAAACCTCTTTATTACAAGCAAAATGGAAGAGACACCCCAGTCAAATATTTCCTGACGGGTCGGCATGACGGC
CACTCCCTGTCGCGATTGCAAAGGCTGCACCCGGACCAGATTGAAAACTGCCACAATCCAGATCTTGAGGAACTC
ACCGCGGAAACCATTGGGGATGACATTAAACGTTTCTTAAAATTTCGACTCCAAGAGGTCCCAGCTCTCTGGGAC
GGCGATAAGGATCCTTGGGCCAATGCCAAAAACGTCGATACTCTCGGTCAATTGGTCACCAAAGCCTGTCCTTTA
TTCGAATTCGCAGCCACAGCCTGTCGCTTGATTGAGGATGACAATCTTCTAGGAGATGCCAAGTCCCGTCTCTAT
GATATACTAGCCACCAAGTGTAATGGAGACCTCGACCACCTATATTGGACGGTATTGAATACAAGACTCCGCAGC
TCCGACGATAAAATTGCACCACGGCGGCAGAAAATGGTGGAGGAGCAATTTCGTCGCGTTATTGGCTCAGTAATG
AGCCTAGCGGATCCTGTTTCGGTTTCATGTCTTGCCCACCTGTTGGGCGAAACAAAGGCCATGGTCGTCAATGAG
CTACGGCACTTTAAATCGGTTTTGGACGTTCCATCGAATGATGATAGGGTTATCAAGATATTCCATGAATCATTT
AGAGATTTTTTCCACGGGTCGGCTCAAGGGGAGTTTGGACTTGATGAGCGAAAAACTCACGAGCATTTGGCACTT
CGATGTCGTGAGCTTCTTTGCGGAAAGGATGGCAAGAAGGATGCTCTGCGCGAAAATTTCTGCGAGTTGGAGTCA
CCTGGAGCCTATAGAAGAGAAATTCCCGAGAAAGTCCTTTGCGAGTCTATATCGCCAGAGGTTCAGTATGCATGT
CGATTTTGGGTTCACCACTTGAAAAACAGCGACGATAAGATTAAGGACAATGATGCTTGGTACCAACTACTTCAT
AAGCACTTTTTACACTGGCTCGAGGCCCTTGGTCTCTTGGGCAGAATATCGGAAAGCGTGCAGTTTGTCAAGGAG
CTGCAAACCTTGGTAGAATCGAATGCTGGTACCCAGATTGAGGCGTTCCTTAAGGATGCAGAGCGTTTTATATGC
AAATTTTGTCCCATCGTAAATGAGGCACCATTGCAGCTCTACATTTCGGGGCTGACTTTTGCACCAACTGAGAGC
ATTATTAGAAGGACATTTGACACCCATCGTCCAATGTGGATAACCCGTCTTCCAGAAGTCGGAGCGCACTGGAGT
CCATGCTTGCAAACTCTTCCGTTCAGTGTCTATGACAATGCCTGTCTTGTCTCCTCCTCAGAAGGTCTATTGGCA
GTCGGACATGAGGATGGAGATATAGAGATGTGGGACCCCATAGCAGGCATACGCCTCAAGTTTTTTGATCCAAGT
TCCGGGTCCGAACCTTTGTCGGAAATTTCGTCTTTGGCGCTCTCACAAACTGGCAAGCTTGCTTGTGCAACAGAG
ACTTCAATCATCGTGTGGGATATAACCCAAGACAATCACTTGAATTCCCTGACTTTGAATAGAGATGAAGGCAAG
GTCATTTCAATGGCTTTCAGAAACGGCCAACATCTATTATTCGCAACTATTGAAGGGAAAATAGCGTCATGGGAT
ATAGGAAATGGACCTCCCAGACACCTCGAGATTTGTTGCAATCTTTACAAGCCAATTCTATCCAACGACGGCCGT
TGGATTGCAGGTTTTGACGAATTGGGTGTAACGCTTATCGCGACAGAGGCGAAGCCCGGCTGCCCGCCCAAAAAG
TTGACTCTTGATGCCGGTAGAAAAACTTCAATCATGCGCTTTTCGCCAGGTGGCCAATACTTGGCAATCGCCTAC
GTATTTCATGAACATCAGAATTTGGGCAATGTTGAGGTCTGGGACACTGTATCCACTCAACGTCTACAATCCTTG
GACACCGGACTTGTCTGGTCACTGGCAGTCTCGGCAGATAATCGAAGGCTTGCGACGGCTAAGAAAGAAATCGTT
ATCTGGGACTGGGAAAATGGTTCTCGTCTCCAGGTTTTTGATCCGGGTGACGAAATCATTGATTCCTTGGCCTTC
TCGCCAAAGGGGTCATGGCTCGCTTCGTCAGACGAAGTAAACGGGGTACAGATCTGGGACGTCGCGGCTTCTTAT
TATGGGACCCCTGGAACGCCTGGAACGCACAGAAGTTGTATCAAGTCGATTGCAATGTCCATGGATGGAGAGCGA
CTCATTTCTGGGTCCTTGAGCAGATATGAATTATGGGAAAAGAGTGGAAGCATCTGCTTTCCACAGCCACTCCAT
GGCGGAGAGAGTTGGTATGAGCGAAGAGAGGGATTATATGAGCCAATAGTGGCCATTTCGGCGAATGGCGAGGTG
GTGGCAATGAACTGCGAGTCAGGAGTTGAAATCCAGAATTTAAAGTCGGGAATTTGTTTGCCGCTCTTGCCCAGG
AATTGGACAAGGTTATATTCCATGACACTTTCAGCCAATGGCGAGAGACTCTTGCTAGGCCTTAAGTCTGGTCCC
CGGGTTGGGGGCTGTGGGTTAGTATGGTCGACGAGCAAAGGTAAACGGCTAAAAGAGATAGATATTCCTCTGCGC
CGATGGGTTGACGTCGGCGCCGCAATGTCATTAGATGGCCAAAAAGTCGCGTTGGTCTTTGATTCGACGGTTCAC
GTCGAAAATCTATGCACAAATCAATTGCTTAAGCGTAAGCTCCTAAGAGTTACGCAAGCTGCCTTTTCGGAGGAT
GGACAACGGGTGGCAGCTCTCTCCCAGACATGTGATGGGGGTATTTGGGAAGTGGAAACAGGTGTCTGTTTAAGG
AGATTCCGAAACGAGGATCCCAATGGAGTTTTGTGCCTGGATATTAAGTTAATCGACGTTGACTTTGCGGTGGCT
GGCGACTTACCAGAGCAACTGCCATTGATGGATTGCTTGATAGACGGGGGGTATGTGAGTCATGACTGTGAGTGG
CTGATGAAGGGTACGAATAGGGTACTACGGCTGCCTAGAGATTCTTGGCCCACATGTACAGCTGTTTCAAAGGCA
CATATTGCAGTTGGGCTTGTTTCAGGCCACGCTTTTGTTGTTGGTATGGCATGGGATAATATCCCAGGGGATTGC
AAGGCGGTTGACGTATCTCAAGATTCAGACGAGGATTCAGAAGAGGATTCAGACGAGGAGTCGGACGAGGATTCA
GAAGGGGATTCAGACGAGGAGTCGGACGAGGATTCAGACGAGAATTCAGACCAAGAATCGGACGAGGATTCAGAC
GAGAATTCAGACGAGGAGTCGGATGAGGAGTCGGACGAGGATTCAGAGGAGATTTGA
Transcript >OphauG2|2977
ATGGCTCAGCTAGTGGAAGCATTGCCAGGCCTTGCCAAGGACGTTGAGGATGTCTTGGACTCTAACCATTCGATT
GTTGATCAAGATTTCAGGAACCAATTCGAGAAGCTTTATCGAGGACCTTTGCAAAAATCCGATTCTAAATCCAAA
AACATAGTAATTGTCATTGACGCTCTGGACGAATGTGATTCACAGACGGAAATCTCGGATCTGCTAAGACTGCTC
TCGAAACCTCTTTATTACAAGCAAAATGGAAGAGACACCCCAGTCAAATATTTCCTGACGGGTCGGCATGACGGC
CACTCCCTGTCGCGATTGCAAAGGCTGCACCCGGACCAGATTGAAAACTGCCACAATCCAGATCTTGAGGAACTC
ACCGCGGAAACCATTGGGGATGACATTAAACGTTTCTTAAAATTTCGACTCCAAGAGGTCCCAGCTCTCTGGGAC
GGCGATAAGGATCCTTGGGCCAATGCCAAAAACGTCGATACTCTCGGTCAATTGGTCACCAAAGCCTGTCCTTTA
TTCGAATTCGCAGCCACAGCCTGTCGCTTGATTGAGGATGACAATCTTCTAGGAGATGCCAAGTCCCGTCTCTAT
GATATACTAGCCACCAAGTGTAATGGAGACCTCGACCACCTATATTGGACGGTATTGAATACAAGACTCCGCAGC
TCCGACGATAAAATTGCACCACGGCGGCAGAAAATGGTGGAGGAGCAATTTCGTCGCGTTATTGGCTCAGTAATG
AGCCTAGCGGATCCTGTTTCGGTTTCATGTCTTGCCCACCTGTTGGGCGAAACAAAGGCCATGGTCGTCAATGAG
CTACGGCACTTTAAATCGGTTTTGGACGTTCCATCGAATGATGATAGGGTTATCAAGATATTCCATGAATCATTT
AGAGATTTTTTCCACGGGTCGGCTCAAGGGGAGTTTGGACTTGATGAGCGAAAAACTCACGAGCATTTGGCACTT
CGATGTCGTGAGCTTCTTTGCGGAAAGGATGGCAAGAAGGATGCTCTGCGCGAAAATTTCTGCGAGTTGGAGTCA
CCTGGAGCCTATAGAAGAGAAATTCCCGAGAAAGTCCTTTGCGAGTCTATATCGCCAGAGGTTCAGTATGCATGT
CGATTTTGGGTTCACCACTTGAAAAACAGCGACGATAAGATTAAGGACAATGATGCTTGGTACCAACTACTTCAT
AAGCACTTTTTACACTGGCTCGAGGCCCTTGGTCTCTTGGGCAGAATATCGGAAAGCGTGCAGTTTGTCAAGGAG
CTGCAAACCTTGGTAGAATCGAATGCTGGTACCCAGATTGAGGCGTTCCTTAAGGATGCAGAGCGTTTTATATGC
AAATTTTGTCCCATCGTAAATGAGGCACCATTGCAGCTCTACATTTCGGGGCTGACTTTTGCACCAACTGAGAGC
ATTATTAGAAGGACATTTGACACCCATCGTCCAATGTGGATAACCCGTCTTCCAGAAGTCGGAGCGCACTGGAGT
CCATGCTTGCAAACTCTTCCGTTCAGTGTCTATGACAATGCCTGTCTTGTCTCCTCCTCAGAAGGTCTATTGGCA
GTCGGACATGAGGATGGAGATATAGAGATGTGGGACCCCATAGCAGGCATACGCCTCAAGTTTTTTGATCCAAGT
TCCGGGTCCGAACCTTTGTCGGAAATTTCGTCTTTGGCGCTCTCACAAACTGGCAAGCTTGCTTGTGCAACAGAG
ACTTCAATCATCGTGTGGGATATAACCCAAGACAATCACTTGAATTCCCTGACTTTGAATAGAGATGAAGGCAAG
GTCATTTCAATGGCTTTCAGAAACGGCCAACATCTATTATTCGCAACTATTGAAGGGAAAATAGCGTCATGGGAT
ATAGGAAATGGACCTCCCAGACACCTCGAGATTTGTTGCAATCTTTACAAGCCAATTCTATCCAACGACGGCCGT
TGGATTGCAGGTTTTGACGAATTGGGTGTAACGCTTATCGCGACAGAGGCGAAGCCCGGCTGCCCGCCCAAAAAG
TTGACTCTTGATGCCGGTAGAAAAACTTCAATCATGCGCTTTTCGCCAGGTGGCCAATACTTGGCAATCGCCTAC
GTATTTCATGAACATCAGAATTTGGGCAATGTTGAGGTCTGGGACACTGTATCCACTCAACGTCTACAATCCTTG
GACACCGGACTTGTCTGGTCACTGGCAGTCTCGGCAGATAATCGAAGGCTTGCGACGGCTAAGAAAGAAATCGTT
ATCTGGGACTGGGAAAATGGTTCTCGTCTCCAGGTTTTTGATCCGGGTGACGAAATCATTGATTCCTTGGCCTTC
TCGCCAAAGGGGTCATGGCTCGCTTCGTCAGACGAAGTAAACGGGGTACAGATCTGGGACGTCGCGGCTTCTTAT
TATGGGACCCCTGGAACGCCTGGAACGCACAGAAGTTGTATCAAGTCGATTGCAATGTCCATGGATGGAGAGCGA
CTCATTTCTGGGTCCTTGAGCAGATATGAATTATGGGAAAAGAGTGGAAGCATCTGCTTTCCACAGCCACTCCAT
GGCGGAGAGAGTTGGTATGAGCGAAGAGAGGGATTATATGAGCCAATAGTGGCCATTTCGGCGAATGGCGAGGTG
GTGGCAATGAACTGCGAGTCAGGAGTTGAAATCCAGAATTTAAAGTCGGGAATTTGTTTGCCGCTCTTGCCCAGG
AATTGGACAAGGTTATATTCCATGACACTTTCAGCCAATGGCGAGAGACTCTTGCTAGGCCTTAAGTCTGGTCCC
CGGGTTGGGGGCTGTGGGTTAGTATGGTCGACGAGCAAAGGTAAACGGCTAAAAGAGATAGATATTCCTCTGCGC
CGATGGGTTGACGTCGGCGCCGCAATGTCATTAGATGGCCAAAAAGTCGCGTTGGTCTTTGATTCGACGGTTCAC
GTCGAAAATCTATGCACAAATCAATTGCTTAAGCGTAAGCTCCTAAGAGTTACGCAAGCTGCCTTTTCGGAGGAT
GGACAACGGGTGGCAGCTCTCTCCCAGACATGTGATGGGGGTATTTGGGAAGTGGAAACAGGTGTCTGTTTAAGG
AGATTCCGAAACGAGGATCCCAATGGAGTTTTGTGCCTGGATATTAAGTTAATCGACGTTGACTTTGCGGTGGCT
GGCGACTTACCAGAGCAACTGCCATTGATGGATTGCTTGATAGACGGGGGGTATGTGAGTCATGACTGTGAGTGG
CTGATGAAGGGTACGAATAGGGTACTACGGCTGCCTAGAGATTCTTGGCCCACATGTACAGCTGTTTCAAAGGCA
CATATTGCAGTTGGGCTTGTTTCAGGCCACGCTTTTGTTGTTGGTATGGCATGGGATAATATCCCAGGGGATTGC
AAGGCGGTTGACGTATCTCAAGATTCAGACGAGGATTCAGAAGAGGATTCAGACGAGGAGTCGGACGAGGATTCA
GAAGGGGATTCAGACGAGGAGTCGGACGAGGATTCAGACGAGAATTCAGACCAAGAATCGGACGAGGATTCAGAC
GAGAATTCAGACGAGGAGTCGGATGAGGAGTCGGACGAGGATTCAGAGGAGATTTGA
Gene >OphauG2|2977
ATGGCTCAGCTAGTGGAAGCATTGCCAGGCCTTGCCAAGGACGTTGAGGATGTCTTGGACTCTAACCATTCGATT
GTTGATCAAGATTTCAGGAACCAATTCGAGAAGCTTTATCGAGGACCTTTGCAAAAATCCGATTCTAAATCCAAA
AACATAGTAATTGTCATTGACGCTCTGGACGAATGTGATTCACAGACGGAAATCTCGGATCTGCTAAGACTGCTC
TCGAAACCTCTTTATTACAAGCAAAATGGAAGAGACACCCCAGTCAAATATTTCCTGACGGGTCGGCATGACGGC
CACTCCCTGTCGCGATTGCAAAGGCTGCACCCGGACCAGATTGAAAACTGCCACAATCCAGATCTTGAGGAACTC
ACCGCGGAAACCATTGGGGATGACATTAAACGTTTCTTAAAATTTCGACTCCAAGAGGTCCCAGCTCTCTGGGAC
GGCGATAAGGATCCTTGGGCCAATGCCAAAAACGTCGATACTCTCGGTCAATTGGTCACCAAAGCCTGTCCTTTA
TTCGAATTCGCAGCCACAGCCTGTCGCTTGATTGAGGATGACAATCTTCTAGGAGATGCCAAGTCCCGTCTCTAT
GATATACTAGCCACCAAGTGTAATGGAGACCTCGACCACCTATATTGGACGGTATTGAATACAAGACTCCGCAGC
TCCGACGATAAAATTGCACCACGGCGGCAGAAAATGGTGGAGGAGCAATTTCGTCGCGTTATTGGCTCAGTAATG
AGCCTAGCGGATCCTGTTTCGGTTTCATGTCTTGCCCACCTGTTGGGCGAAACAAAGGCCATGGTCGTCAATGAG
CTACGGCACTTTAAATCGGTTTTGGACGTTCCATCGAATGATGATAGGGTTATCAAGATATTCCATGAATCATTT
AGAGATTTTTTCCACGGGTCGGCTCAAGGGGAGTTTGGACTTGATGAGCGAAAAACTCACGAGCATTTGGCACTT
CGATGTCGTGAGCTTCTTTGCGGAAAGGATGGCAAGAAGGATGCTCTGCGCGAAAATTTCTGCGAGTTGGAGTCA
CCTGGAGCCTATAGAAGAGAAATTCCCGAGAAAGTCCTTTGCGAGTCTATATCGCCAGAGGTTCAGTATGCATGT
CGATTTTGGGTTCACCACTTGAAAAACAGCGACGATAAGATTAAGGACAATGATGCTTGGTACCAACTACTTCAT
AAGCACTTTTTACACTGGCTCGAGGCCCTTGGTCTCTTGGGCAGAATATCGGAAAGCGTGCAGTTTGTCAAGGAG
CTGCAAACCTTGGTAGAAGTAAGTTGTGATGCCCTCTTTGATGTCATATAGTACTAACTAGACTAGTCGAATGCT
GGTACCCAGATTGAGGCGTTCCTTAAGGATGCAGAGCGTTTTATATGCAAATTTTGTCCCATCGTAAATGAGGCA
CCATTGCAGCTCTACATTTCGGGGCTGACTTTTGCACCAACTGAGAGCATTATTAGAAGGACATTTGACACCCAT
CGTCCAATGTGGATAACCCGTCTTCCAGAAGTCGGAGCGCACTGGAGTCCATGCTTGCAAACTCTTCCGTTCAGT
GTCTATGACAATGCCTGTCTTGTCTCCTCCTCAGAAGGTCTATTGGCAGTCGGACATGAGGATGGAGATATAGAG
ATGTGGGACCCCATAGCAGGCATACGCCTCAAGTTTTTTGATCCAAGTTCCGGGTCCGAACCTTTGTCGGAAATT
TCGTCTTTGGCGCTCTCACAAACTGGCAAGCTTGCTTGTGCAACAGAGACTTCAATCATCGTGTGGGATATAACC
CAAGACAATCACTTGAATTCCCTGACTTTGAATAGAGATGAAGGCAAGGTCATTTCAATGGCTTTCAGAAACGGC
CAACATCTATTATTCGCAACTATTGAAGGGAAAATAGCGTCATGGGATATAGGAAATGGACCTCCCAGACACCTC
GAGATTTGTTGCAATCTTTACAAGCCAATTCTATCCAACGACGGCCGTTGGATTGCAGGTTTTGACGAATTGGGT
GTAACGCTTATCGCGACAGAGGCGAAGCCCGGCTGCCCGCCCAAAAAGTTGACTCTTGATGCCGGTAGAAAAACT
TCAATCATGCGCTTTTCGCCAGGTGGCCAATACTTGGCAATCGCCTACGTATTTCATGAACATCAGAATTTGGGC
AATGTTGAGGTCTGGGACACTGTATCCACTCAACGTCTACAATCCTTGGACACCGGACTTGTCTGGTCACTGGCA
GTCTCGGCAGATAATCGAAGGCTTGCGACGGCTAAGAAAGAAATCGTTATCTGGGACTGGGAAAATGGTTCTCGT
CTCCAGGTTTTTGATCCGGGTGACGAAATCATTGATTCCTTGGCCTTCTCGCCAAAGGGGTCATGGCTCGCTTCG
TCAGACGAAGTAAACGGGGTACAGATCTGGGACGTCGCGGCTTCTTATTATGGGACCCCTGGAACGCCTGGAACG
CACAGAAGTTGTATCAAGTCGATTGCAATGTCCATGGATGGAGAGCGACTCATTTCTGGGTCCTTGAGCAGATAT
GAATTATGGGAAAAGAGTGGAAGCATCTGCTTTCCACAGCCACTCCATGGCGGAGAGAGTTGGTATGAGCGAAGA
GAGGGATTATATGAGCCAATAGTGGCCATTTCGGCGAATGGCGAGGTGGTGGCAATGAACTGCGAGTCAGGAGTT
GAAATCCAGAATTTAAAGTCGGGAATTTGTTTGCCGCTCTTGCCCAGGAATTGGACAAGGTTATATTCCATGACA
CTTTCAGCCAATGGCGAGAGACTCTTGCTAGGCCTTAAGTCTGGTCCCCGGGTTGGGGGCTGTGGGTTAGTATGG
TCGACGAGCAAAGGTAAACGGCTAAAAGAGATAGATATTCCTCTGCGCCGATGGGTTGACGTCGGCGCCGCAATG
TCATTAGATGGCCAAAAAGTCGCGTTGGTCTTTGATTCGACGGTTCACGTCGAAAATCTATGCACAAATCAATTG
CTTAAGCGTAAGCTCCTAAGAGTTACGCAAGCTGCCTTTTCGGAGGATGGACAACGGGTGGCAGCTCTCTCCCAG
ACATGTGATGGGGGTATTTGGGAAGTGGAAACAGGTGTCTGTTTAAGGAGATTCCGAAACGAGGATCCCAATGGA
GTTTTGTGCCTGGATATTAAGTTAATCGACGTTGACTTTGCGGTGGCTGGCGACTTACCAGAGCAACTGCCATTG
ATGGATTGCTTGATAGACGGGGGGTATGTGAGTCATGACTGTGAGTGGCTGATGAAGGGTACGAATAGGGTACTA
CGGCTGCCTAGAGATTCTTGGCCCACATGTACAGCTGTTTCAAAGGCACATATTGCAGTTGGGCTTGTTTCAGGC
CACGCTTTTGTTGTTGGTATGGCATGGGATAATATCCCAGGGGATTGCAAGGCGGTTGACGTATCTCAAGATTCA
GACGAGGATTCAGAAGAGGATTCAGACGAGGAGTCGGACGAGGATTCAGAAGGGGATTCAGACGAGGAGTCGGAC
GAGGATTCAGACGAGAATTCAGACCAAGAATCGGACGAGGATTCAGACGAGAATTCAGACGAGGAGTCGGATGAG
GAGTCGGACGAGGATTCAGAGGAGATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail