Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|297
Gene name
LocationContig_1064:189..2181
Strand+
Gene length (bp)1992
Transcript length (bp)1932
Coding sequence length (bp)1932
Protein length (aa) 644

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17004 SRP_TPR_like Putative TPR-like repeat 2.5E-19 19 150
PF08492 SRP72 SRP72 RNA-binding domain 8.0E-10 549 593

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59787|SRP72_SCHPO Signal recognition particle subunit srp72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp72 PE=3 SV=1 45 610 6.0E-38
sp|P33731|SRP72_CANLF Signal recognition particle subunit SRP72 OS=Canis lupus familiaris GN=SRP72 PE=1 SV=3 20 589 4.0E-31
sp|O76094|SRP72_HUMAN Signal recognition particle subunit SRP72 OS=Homo sapiens GN=SRP72 PE=1 SV=3 20 589 9.0E-31
sp|P91240|SRP72_CAEEL Signal recognition particle subunit SRP72 OS=Caenorhabditis elegans GN=srpa-72 PE=3 SV=2 9 609 1.0E-18
sp|Q54EP7|SRP72_DICDI Signal recognition particle subunit SRP72 OS=Dictyostelium discoideum GN=srp72 PE=3 SV=1 25 534 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59787|SRP72_SCHPO Signal recognition particle subunit srp72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp72 PE=3 SV=1 45 610 6.0E-38
sp|P33731|SRP72_CANLF Signal recognition particle subunit SRP72 OS=Canis lupus familiaris GN=SRP72 PE=1 SV=3 20 589 4.0E-31
sp|O76094|SRP72_HUMAN Signal recognition particle subunit SRP72 OS=Homo sapiens GN=SRP72 PE=1 SV=3 20 589 9.0E-31
sp|P91240|SRP72_CAEEL Signal recognition particle subunit SRP72 OS=Caenorhabditis elegans GN=srpa-72 PE=3 SV=2 9 609 1.0E-18
sp|Q54EP7|SRP72_DICDI Signal recognition particle subunit SRP72 OS=Dictyostelium discoideum GN=srp72 PE=3 SV=1 25 534 3.0E-18
sp|P38688|SRP72_YEAST Signal recognition particle subunit SRP72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP72 PE=1 SV=2 46 624 1.0E-15
sp|P49965|SRP72_SCHMA Signal recognition particle subunit SRP72 OS=Schistosoma mansoni GN=SRP72 PE=3 SV=1 7 615 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0048500 signal recognition particle Yes
GO:0006614 SRP-dependent cotranslational protein targeting to membrane Yes
GO:0008312 7S RNA binding Yes
GO:0051234 establishment of localization No
GO:0033365 protein localization to organelle No
GO:0071705 nitrogen compound transport No
GO:0006605 protein targeting No
GO:0008150 biological_process No
GO:0045047 protein targeting to ER No
GO:0071702 organic substance transport No
GO:0032991 protein-containing complex No
GO:0015031 protein transport No
GO:0006612 protein targeting to membrane No
GO:0051668 localization within membrane No
GO:0006886 intracellular protein transport No
GO:0051179 localization No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0070727 cellular macromolecule localization No
GO:0070972 protein localization to endoplasmic reticulum No
GO:0005488 binding No
GO:0008104 protein localization No
GO:0006810 transport No
GO:0003723 RNA binding No
GO:1990904 ribonucleoprotein complex No
GO:0097159 organic cyclic compound binding No
GO:0072657 protein localization to membrane No
GO:0033036 macromolecule localization No
GO:0003674 molecular_function No
GO:0072594 establishment of protein localization to organelle No
GO:0006613 cotranslational protein targeting to membrane No
GO:0046907 intracellular transport No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0090150 establishment of protein localization to membrane No
GO:0051649 establishment of localization in cell No
GO:0045184 establishment of protein localization No
GO:0051641 cellular localization No
GO:0072599 establishment of protein localization to endoplasmic reticulum No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4836
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|297 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5714
Ophiocordyceps camponoti-floridani Ophcf2|06084
Ophiocordyceps camponoti-rufipedis Ophun1|3869
Ophiocordyceps kimflemingae Ophio5|210
Ophiocordyceps subramaniannii Hirsu2|1079

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|297
MVHDAASALGAMLRAATLNDHDELLKAANAAIKADKQDWTAHQTRVVALLKLDRFDEAVAAISQAGGEIEARCVV
EKAYALYKTGRLQEAAAVVQSCGLGGSRSLNHIAAQVAYRAQDFPEAQAIYARLVAQDAHIEAADIEINVEAIRA
QLQWQQRLSNVPPLCHDDSFELCYNMACREIARAALPSAASLLQRSVRLCDGSDELTDAERKAELKAILAQQAYV
HGRLGNKEQALHLCRSVDLSEKNTDGELSLILHNNMMAFDTIKPSNPFLLERHAAAYTSAAAKSSLFGFQTALMT
RNSALIHLWMHKTDGVRRATRKTMANATHPTSSLQANTASVLLAAAETSRLQSKQLLRKVALLFNKHPNNVGLAL
LNIQLLLSRDKLATALSVLETFLGRLDQPQFQHVRFSPGLVALAVALMRANGRHMGAKLQLAKAASFWCAQPASI
AASLLQEAGVELAKSSNAQDLSLAALAFDKLGNQEQESRIASAGLVAALAASDMSRVQHHLAQLPSVQSLTASVD
VDALVDSGVPIVASRAIGPSKRPVESADSRASKKRRRTKTKLQNIGVEGKVLDPERWLPLRDRSSYRPKGRRAKK
KAADLTQGGIVKEEQRAESLGRGGVNAEKTVATASSKKKKGKR*
Coding >OphauG2|297
ATGGTTCACGACGCCGCCTCGGCCCTGGGCGCCATGCTACGGGCGGCCACGCTCAATGACCACGATGAGCTTCTC
AAGGCGGCCAATGCTGCCATAAAGGCTGACAAGCAAGACTGGACGGCTCACCAGACCAGAGTGGTTGCTCTGCTC
AAGCTTGACCGTTTCGACGAGGCTGTGGCGGCCATTTCTCAAGCCGGCGGGGAGATTGAGGCTCGATGCGTGGTG
GAAAAGGCTTATGCGCTCTACAAGACGGGGCGCCTGCAGGAAGCTGCCGCTGTGGTGCAGTCCTGTGGTCTCGGA
GGCTCAAGAAGCCTCAATCACATTGCAGCCCAGGTGGCCTATCGCGCCCAAGATTTCCCAGAGGCTCAAGCCATT
TATGCCAGGCTTGTGGCCCAAGATGCCCATATTGAGGCGGCTGACATTGAGATAAATGTCGAGGCCATTCGAGCC
CAGTTGCAATGGCAGCAGCGCCTCAGCAACGTCCCCCCTCTCTGCCACGACGACTCGTTTGAGCTCTGCTACAAC
ATGGCATGCCGCGAAATTGCCCGCGCTGCCTTGCCCTCGGCCGCCAGTCTTCTACAGCGCTCTGTCCGGCTTTGT
GACGGTTCAGACGAGTTGACTGACGCAGAGCGCAAGGCCGAGCTCAAGGCCATTCTCGCCCAGCAGGCCTATGTA
CATGGGCGTCTGGGCAACAAGGAGCAAGCGCTGCATCTGTGCCGCTCAGTCGATCTTTCAGAAAAAAACACAGAC
GGCGAACTGAGCTTGATTCTCCACAACAACATGATGGCCTTTGACACGATCAAGCCCTCGAACCCCTTTTTGCTT
GAGCGGCATGCCGCAGCTTACACGTCAGCTGCTGCAAAGTCTAGCCTCTTTGGATTTCAAACCGCCCTCATGACG
CGCAACTCGGCCCTCATTCACCTCTGGATGCACAAGACGGATGGAGTCCGGCGCGCAACACGCAAGACCATGGCA
AATGCGACACATCCAACAAGCAGCTTGCAAGCTAATACCGCCTCGGTCCTCTTGGCTGCAGCCGAGACGAGTCGA
CTGCAAAGTAAGCAGCTCTTGCGCAAAGTTGCCCTCCTCTTCAACAAGCACCCCAACAATGTCGGTCTGGCTCTC
TTGAACATCCAGCTTCTCTTATCCAGAGACAAGCTTGCGACAGCGCTTTCGGTGCTCGAGACATTCCTTGGCCGT
CTGGACCAGCCCCAATTTCAACATGTCCGTTTCAGCCCTGGTCTCGTGGCTTTGGCTGTTGCTCTGATGCGAGCA
AATGGAAGGCATATGGGTGCAAAACTTCAACTAGCCAAGGCGGCGTCGTTTTGGTGTGCCCAGCCCGCCTCCATT
GCTGCCTCTCTTTTGCAAGAAGCCGGCGTCGAGTTAGCCAAGTCTTCAAATGCACAGGACCTGTCGCTGGCTGCC
TTGGCTTTTGACAAGCTAGGCAATCAGGAACAAGAGTCGCGCATTGCATCAGCTGGCTTGGTGGCGGCCCTGGCT
GCATCCGACATGTCCCGTGTCCAGCACCATCTTGCCCAATTGCCGTCTGTGCAAAGCTTGACAGCGAGCGTCGAC
GTCGACGCCCTGGTAGATTCCGGTGTTCCCATTGTCGCAAGCCGTGCCATTGGCCCTTCAAAGCGCCCGGTCGAG
TCTGCCGACAGTAGGGCCTCCAAGAAGCGGCGTAGGACCAAGACGAAATTGCAAAACATAGGCGTCGAGGGCAAG
GTGCTTGATCCAGAGCGGTGGCTGCCTCTACGCGATCGCTCGTCTTATCGTCCCAAGGGTAGACGCGCCAAGAAG
AAGGCGGCTGATCTTACACAAGGCGGTATAGTCAAGGAGGAACAGAGGGCTGAGTCGCTGGGACGAGGTGGCGTC
AACGCCGAAAAGACTGTGGCCACAGCTTCTTCAAAGAAAAAGAAGGGCAAAAGATGA
Transcript >OphauG2|297
ATGGTTCACGACGCCGCCTCGGCCCTGGGCGCCATGCTACGGGCGGCCACGCTCAATGACCACGATGAGCTTCTC
AAGGCGGCCAATGCTGCCATAAAGGCTGACAAGCAAGACTGGACGGCTCACCAGACCAGAGTGGTTGCTCTGCTC
AAGCTTGACCGTTTCGACGAGGCTGTGGCGGCCATTTCTCAAGCCGGCGGGGAGATTGAGGCTCGATGCGTGGTG
GAAAAGGCTTATGCGCTCTACAAGACGGGGCGCCTGCAGGAAGCTGCCGCTGTGGTGCAGTCCTGTGGTCTCGGA
GGCTCAAGAAGCCTCAATCACATTGCAGCCCAGGTGGCCTATCGCGCCCAAGATTTCCCAGAGGCTCAAGCCATT
TATGCCAGGCTTGTGGCCCAAGATGCCCATATTGAGGCGGCTGACATTGAGATAAATGTCGAGGCCATTCGAGCC
CAGTTGCAATGGCAGCAGCGCCTCAGCAACGTCCCCCCTCTCTGCCACGACGACTCGTTTGAGCTCTGCTACAAC
ATGGCATGCCGCGAAATTGCCCGCGCTGCCTTGCCCTCGGCCGCCAGTCTTCTACAGCGCTCTGTCCGGCTTTGT
GACGGTTCAGACGAGTTGACTGACGCAGAGCGCAAGGCCGAGCTCAAGGCCATTCTCGCCCAGCAGGCCTATGTA
CATGGGCGTCTGGGCAACAAGGAGCAAGCGCTGCATCTGTGCCGCTCAGTCGATCTTTCAGAAAAAAACACAGAC
GGCGAACTGAGCTTGATTCTCCACAACAACATGATGGCCTTTGACACGATCAAGCCCTCGAACCCCTTTTTGCTT
GAGCGGCATGCCGCAGCTTACACGTCAGCTGCTGCAAAGTCTAGCCTCTTTGGATTTCAAACCGCCCTCATGACG
CGCAACTCGGCCCTCATTCACCTCTGGATGCACAAGACGGATGGAGTCCGGCGCGCAACACGCAAGACCATGGCA
AATGCGACACATCCAACAAGCAGCTTGCAAGCTAATACCGCCTCGGTCCTCTTGGCTGCAGCCGAGACGAGTCGA
CTGCAAAGTAAGCAGCTCTTGCGCAAAGTTGCCCTCCTCTTCAACAAGCACCCCAACAATGTCGGTCTGGCTCTC
TTGAACATCCAGCTTCTCTTATCCAGAGACAAGCTTGCGACAGCGCTTTCGGTGCTCGAGACATTCCTTGGCCGT
CTGGACCAGCCCCAATTTCAACATGTCCGTTTCAGCCCTGGTCTCGTGGCTTTGGCTGTTGCTCTGATGCGAGCA
AATGGAAGGCATATGGGTGCAAAACTTCAACTAGCCAAGGCGGCGTCGTTTTGGTGTGCCCAGCCCGCCTCCATT
GCTGCCTCTCTTTTGCAAGAAGCCGGCGTCGAGTTAGCCAAGTCTTCAAATGCACAGGACCTGTCGCTGGCTGCC
TTGGCTTTTGACAAGCTAGGCAATCAGGAACAAGAGTCGCGCATTGCATCAGCTGGCTTGGTGGCGGCCCTGGCT
GCATCCGACATGTCCCGTGTCCAGCACCATCTTGCCCAATTGCCGTCTGTGCAAAGCTTGACAGCGAGCGTCGAC
GTCGACGCCCTGGTAGATTCCGGTGTTCCCATTGTCGCAAGCCGTGCCATTGGCCCTTCAAAGCGCCCGGTCGAG
TCTGCCGACAGTAGGGCCTCCAAGAAGCGGCGTAGGACCAAGACGAAATTGCAAAACATAGGCGTCGAGGGCAAG
GTGCTTGATCCAGAGCGGTGGCTGCCTCTACGCGATCGCTCGTCTTATCGTCCCAAGGGTAGACGCGCCAAGAAG
AAGGCGGCTGATCTTACACAAGGCGGTATAGTCAAGGAGGAACAGAGGGCTGAGTCGCTGGGACGAGGTGGCGTC
AACGCCGAAAAGACTGTGGCCACAGCTTCTTCAAAGAAAAAGAAGGGCAAAAGATGA
Gene >OphauG2|297
ATGGTTCACGACGCCGCCTCGGCCCTGGGCGCCATGCTACGGGCGGCCACGCTCAATGACCACGATGAGCTTCTC
AAGGCGGCCAATGCTGCCATAAAGGCTGACAAGCAAGACTGGACGGCTCACCAGACCAGAGTGGTTGCTCTGCTC
AAGCTTGACCGTTTCGACGAGGCTGTGGCGGCCATTTCTCAAGCCGGCGGGGAGATTGAGGCTCGATGCGTGGTG
GAAAAGGCTTATGCGCTCTACAAGACGGGGCGCCTGCAGGAAGCTGCCGCTGTGGTGCAGTCCTGTGGTCTCGGA
GGCTCAAGAAGCCTCAATCACATTGCAGCCCAGGTGGCCTATCGCGCCCAAGATTTCCCAGAGGCTCAAGCCATT
TATGCCAGGCTTGTGGCCCAAGATGCCCATATTGAGGCGGCTGACATTGAGATAAATGTCGAGGCCATTCGAGCC
CAGTTGCAATGGCAGCAGCGCCTCAGCAACGTCCCCCCTCTCTGCCACGACGACTCGTTTGAGCTCTGCTACAAC
ATGGCATGCCGCGAAATTGCCCGCGCTGCCTTGCCCTCGGCCGCCAGTCTTCTACAGCGCTCTGTCCGGCTTTGT
GACGGTTCAGACGAGTTGACTGACGCAGAGCGCAAGGCCGAGCTCAAGGCCATTCTCGCCCAGCAGGCCTATGTA
CATGGGCGTCTGGGCAACAAGGAGCAAGCGCTGCATCTGTGCCGCTCAGTCGATCTTTCAGAGTCAGTCATGCAT
TGTACCGCTAGCATCATGGTGGCTGACCAAGGCCTTGATGCCCCTAGAAAAAACACAGACGGCGAACTGAGCTTG
ATTCTCCACAACAACATGATGGCCTTTGACACGATCAAGCCCTCGAACCCCTTTTTGCTTGAGCGGCATGCCGCA
GCTTACACGTCAGCTGCTGCAAAGTCTAGCCTCTTTGGATTTCAAACCGCCCTCATGACGCGCAACTCGGCCCTC
ATTCACCTCTGGATGCACAAGACGGATGGAGTCCGGCGCGCAACACGCAAGACCATGGCAAATGCGACACATCCA
ACAAGCAGCTTGCAAGCTAATACCGCCTCGGTCCTCTTGGCTGCAGCCGAGACGAGTCGACTGCAAAGTAAGCAG
CTCTTGCGCAAAGTTGCCCTCCTCTTCAACAAGCACCCCAACAATGTCGGTCTGGCTCTCTTGAACATCCAGCTT
CTCTTATCCAGAGACAAGCTTGCGACAGCGCTTTCGGTGCTCGAGACATTCCTTGGCCGTCTGGACCAGCCCCAA
TTTCAACATGTCCGTTTCAGCCCTGGTCTCGTGGCTTTGGCTGTTGCTCTGATGCGAGCAAATGGAAGGCATATG
GGTGCAAAACTTCAACTAGCCAAGGCGGCGTCGTTTTGGTGTGCCCAGCCCGCCTCCATTGCTGCCTCTCTTTTG
CAAGAAGCCGGCGTCGAGTTAGCCAAGTCTTCAAATGCACAGGACCTGTCGCTGGCTGCCTTGGCTTTTGACAAG
CTAGGCAATCAGGAACAAGAGTCGCGCATTGCATCAGCTGGCTTGGTGGCGGCCCTGGCTGCATCCGACATGTCC
CGTGTCCAGCACCATCTTGCCCAATTGCCGTCTGTGCAAAGCTTGACAGCGAGCGTCGACGTCGACGCCCTGGTA
GATTCCGGTGTTCCCATTGTCGCAAGCCGTGCCATTGGCCCTTCAAAGCGCCCGGTCGAGTCTGCCGACAGTAGG
GCCTCCAAGAAGCGGCGTAGGACCAAGACGAAATTGCAAAACATAGGCGTCGAGGGCAAGGTGCTTGATCCAGAG
CGGTGGCTGCCTCTACGCGATCGCTCGTCTTATCGTCCCAAGGGTAGACGCGCCAAGAAGAAGGCGGCTGATCTT
ACACAAGGCGGTATAGTCAAGGAGGAACAGAGGGCTGAGTCGCTGGGACGAGGTGGCGTCAACGCCGAAAAGACT
GTGGCCACAGCTTCTTCAAAGAAAAAGAAGGGCAAAAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail