Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2969
Gene name
LocationContig_218:8704..13600
Strand-
Gene length (bp)4896
Transcript length (bp)4650
Coding sequence length (bp)4650
Protein length (aa) 1550

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19050 PhoD_2 PhoD related phosphatase 9.4E-42 835 1087
PF19050 PhoD_2 PhoD related phosphatase 2.1E-21 1096 1254

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53326|YG5L_YEAST Uncharacterized protein YGR266W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR266W PE=1 SV=1 797 1249 3.0E-108

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5159
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2969 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6329
Ophiocordyceps camponoti-floridani Ophcf2|02639
Ophiocordyceps kimflemingae Ophio5|7417
Ophiocordyceps subramaniannii Hirsu2|3657

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2969
MSAAPYWGQLPDAKTAKEAHDGLPSDHAHSIHVPPVPRRPRRNSIAMTDSYTDTTFSPHTPLTPSFGLAPRPLSI
HRGPDAPPQSMPRPNNHFPPVSHPAAAPDPRGPSLGHRPAYSNGDAPYPHPSGPPNARPRPQPIYQDPRGDLDFG
VAVNYAPRRDAPQESYQRPIHDMQPRLDPPPAAIEGAVQPEPPVAMRQSERRRNMTKEEKRARVEAAEQRARQRA
DKAHDSPTIPSQQVPSDHHFVFAARRHQADTATEHQPASPRLQSNAMPPHGDLPPQRHPIPPNRERPQRTYNNPR
LVPEQQASQDGEPTAATFPQRNLSFRERASTNDAQSPSSAQVRQRPFANTEGYPPPLNTNIHKVRKEPPRDFEYR
QQLLGNRSVSGPGPLLTATPARVRTLPVPLPDKQLALAPMNPPLEAAAIPDSHVASHPAWASDKQPPPPALQGVR
RHVTEPIYARKADVVVDQASPLERNQIHDQPPIQGTAGSEQLAAPQQDAHKSLEYKDQLARQDSPDMSDQDARNE
HSGVLRRQESLKPGDGLYKAPEWLSEWKRATTGLLSGALLDMGDTQPTIGPGRYPRDMGARGPSSTYSSSRRWRA
EAFDGEYKDANAPTRFKPPLYLSCGPLLRYRGIRRERFPTRSPRGDTSVSEREIWRGSIMIVTKDSDSSYEISPT
LRLFVQQVKLLPPPPHQIRGETPPEYVDPIAGHPKLGRSGETLYVRPVEDLEEARDHSLDETNKGIFETAKQTAN
MQPGDSETDCPGSFTNRRKAIDIDGEKLQKFKDVRGFRLHAERGCTFWRFNIEVELRDEQQRIAYRINRGPSMGF
WVPPRGEAMNIMFYSCNGFSPNVKTDELSGPDPMWRDVLNSHQSRPFHVMIGGGDQIYNDRLAYNSPLFDGWLEE
RDPHEKRNAPFSAAMQDELEAFYLERYCTWFSQGLFGLAVSQIPMVNMYDNHDVFDGYGSYPHLNMASPVFCGLG
AVAFKYYMLFQHQSLVTETEKSEPSWILGVEPGPYMKELSHSVYVSLGGKVALLAVDCRTERTESEVVREKTWEK
MMNRMYSEIRRGQMEHLLLVLGTPIAYPRLVWLENILTSRLMGPVKALGKTGMLGKAMNDIDGGADARDDLNEHW
TAKKHKQERSLIIEDLQDLAIDKSLRITILSGDVHMAAVGQFFSSPKLGLPKHRDPRYMPNVIASPMVNAPPSDL
MADVINKRNKMHHFDKQTDENMIPLFRHGVDGKVRNNAHLLPHRNWCSISLWTPGSTPPPTPPHSSYEERHSPAP
HASSSGGLLRRFSSRRKSAPRRIEGGHESVRGPRPPISGGMGLFHNISRRLSWSDGQGLMRTMSLGRGEGKDRGY
LNYAYRNSESQPGGDEGEVDGHWHTDSYDGLGSAPGRAAPPRPSGLRGGALHEDEYKDDDESYFSASHPARLAHT
TDSLPGPTTHLADSPPRRAFHRTPTGLSAKQLRQPERFQVDVEGALEVVLNIEVSPRDPAGITVPYRLLVPRLQY
EYNPSEDDIALKEQAEGSALKRLLGLGKRTEKVRCYELEGTETDEAVHG*
Coding >OphauG2|2969
ATGTCGGCCGCGCCGTACTGGGGCCAGCTGCCCGACGCAAAGACGGCCAAGGAGGCCCATGATGGCTTGCCATCC
GACCACGCCCATTCTATCCATGTTCCCCCGGTGCCGCGCCGCCCACGCCGCAACTCCATCGCAATGACTGATAGC
TACACCGACACCACCTTTAGCCCTCACACGCCTCTCACCCCCAGCTTTGGCCTCGCTCCTCGCCCGCTGTCCATT
CATCGCGGCCCCGATGCGCCTCCACAGAGCATGCCTCGCCCCAACAACCATTTCCCCCCCGTCTCTCACCCTGCT
GCTGCTCCGGATCCGCGAGGGCCGTCCCTCGGCCATCGTCCCGCCTACTCCAACGGCGATGCCCCCTATCCCCAT
CCGTCTGGCCCACCCAATGCTAGACCACGACCACAGCCCATTTACCAGGATCCGCGAGGAGACTTGGACTTTGGC
GTCGCCGTTAACTATGCCCCAAGGCGCGATGCCCCCCAAGAATCCTATCAGAGACCTATACACGACATGCAGCCT
CGCCTCGATCCACCACCCGCTGCCATAGAGGGCGCTGTGCAGCCCGAGCCACCCGTCGCAATGAGGCAATCAGAG
CGCCGCAGAAACATGACCAAGGAGGAAAAGAGAGCTAGAGTCGAAGCAGCTGAGCAGAGAGCTAGACAGCGAGCC
GACAAGGCCCACGACTCGCCAACTATCCCAAGCCAACAGGTGCCATCCGACCACCATTTTGTCTTTGCTGCGCGC
CGTCACCAAGCAGACACGGCCACCGAGCACCAGCCTGCTTCGCCTAGACTTCAAAGCAATGCTATGCCGCCCCAT
GGTGACTTGCCGCCCCAACGCCACCCGATTCCCCCTAACCGTGAACGACCCCAACGCACTTACAACAATCCCAGA
TTGGTGCCCGAGCAGCAAGCATCCCAGGATGGTGAGCCGACTGCAGCGACGTTTCCCCAACGAAATCTGAGCTTC
CGTGAGCGTGCTTCTACAAATGATGCACAGTCTCCCAGCTCTGCCCAAGTGCGACAACGCCCCTTTGCCAATACA
GAAGGCTATCCTCCTCCCCTCAACACAAACATACACAAGGTGAGAAAAGAGCCGCCGAGAGACTTTGAGTACCGC
CAGCAACTCTTGGGCAATCGATCGGTCTCGGGACCGGGCCCGCTTCTGACCGCGACACCTGCCCGTGTTAGAACC
TTGCCCGTGCCACTGCCGGACAAGCAACTAGCCCTAGCGCCCATGAATCCACCATTGGAAGCAGCAGCAATCCCA
GATAGTCATGTGGCCTCGCATCCGGCTTGGGCCTCGGACAAACAGCCGCCACCTCCTGCCTTGCAAGGGGTTCGA
CGACATGTCACTGAGCCCATCTACGCAAGGAAAGCCGACGTTGTTGTTGATCAAGCCTCGCCTTTAGAAAGAAAT
CAAATACATGACCAACCGCCAATCCAAGGCACTGCCGGCAGTGAGCAACTAGCCGCTCCTCAGCAAGACGCGCAC
AAGTCGTTGGAATACAAGGACCAGCTGGCAAGACAGGATAGCCCCGACATGTCAGATCAAGATGCCCGCAATGAG
CATTCTGGCGTCTTGAGGAGACAGGAGAGTTTGAAGCCGGGCGATGGCCTATACAAGGCACCAGAATGGCTCAGT
GAATGGAAGAGGGCAACAACAGGGCTACTTTCTGGTGCCCTGTTGGACATGGGCGACACACAACCTACTATAGGC
CCCGGCAGATACCCGCGCGACATGGGCGCTCGGGGGCCGAGCAGCACCTATTCATCGTCTCGCCGATGGAGAGCC
GAGGCTTTTGACGGAGAATATAAAGATGCCAATGCACCAACACGGTTCAAGCCGCCTTTGTATCTTAGCTGCGGT
CCGCTGTTGAGATACCGTGGCATTCGGCGAGAACGGTTTCCTACTAGGTCTCCCAGAGGCGACACCTCAGTGTCG
GAGCGAGAGATTTGGAGAGGTAGCATCATGATTGTGACCAAGGACTCGGATTCATCGTATGAGATATCGCCAACG
TTGCGTCTCTTTGTTCAGCAAGTCAAACTGCTACCTCCTCCACCTCACCAGATTAGGGGGGAGACACCGCCTGAA
TACGTAGATCCCATAGCTGGCCACCCCAAGTTGGGCCGATCCGGCGAGACGTTGTATGTGCGTCCAGTCGAGGAC
CTCGAAGAAGCCAGAGACCATTCTCTTGATGAAACGAACAAGGGAATTTTTGAGACGGCGAAGCAGACTGCAAAT
ATGCAGCCTGGAGATAGTGAAACGGATTGTCCAGGATCATTTACGAACCGCCGAAAGGCTATTGACATTGACGGC
GAAAAGCTGCAAAAGTTCAAGGATGTGAGAGGATTCCGTCTACACGCCGAACGAGGGTGTACCTTTTGGAGGTTC
AACATTGAAGTGGAGCTACGAGACGAGCAACAGCGCATTGCATACCGCATCAATCGCGGACCCTCCATGGGCTTT
TGGGTGCCGCCGCGGGGTGAGGCTATGAACATCATGTTCTACAGCTGCAACGGCTTTAGTCCCAATGTCAAGACG
GACGAGCTGAGCGGACCGGATCCCATGTGGAGAGACGTACTCAACTCGCATCAGTCGCGCCCGTTTCATGTCATG
ATTGGAGGCGGCGACCAAATTTACAATGATCGACTGGCGTACAACAGTCCTCTATTTGATGGTTGGCTGGAAGAG
AGGGATCCGCACGAGAAGCGCAACGCACCCTTCAGCGCAGCAATGCAGGACGAGCTCGAGGCTTTTTACTTGGAG
CGGTATTGCACATGGTTCTCTCAGGGTCTCTTTGGGCTGGCCGTGTCTCAGATACCCATGGTCAACATGTACGAC
AACCATGACGTCTTTGACGGCTATGGCTCGTACCCGCATCTCAACATGGCCTCGCCCGTCTTTTGTGGACTCGGA
GCTGTGGCATTCAAATACTATATGCTCTTTCAACATCAGAGCCTGGTAACCGAAACGGAAAAGTCGGAGCCAAGC
TGGATCTTGGGTGTGGAACCCGGGCCATACATGAAGGAGCTCAGCCATAGCGTCTATGTATCTCTGGGAGGCAAA
GTGGCATTGCTGGCTGTTGACTGTCGCACCGAGAGAACAGAGTCCGAGGTTGTTCGAGAGAAGACGTGGGAAAAG
ATGATGAATCGCATGTACTCGGAGATTAGACGGGGGCAGATGGAGCATCTCTTGTTGGTTCTGGGAACGCCCATT
GCCTATCCTCGGCTTGTCTGGCTGGAAAACATTTTGACATCGAGGCTCATGGGCCCGGTCAAGGCGCTGGGCAAA
ACGGGCATGCTAGGCAAAGCCATGAATGATATCGACGGCGGTGCTGACGCGCGAGACGACCTGAACGAGCACTGG
ACGGCCAAGAAGCACAAGCAAGAACGTAGTCTTATTATTGAGGACTTGCAGGATCTCGCCATTGACAAGTCTTTG
CGCATCACGATTCTCAGCGGCGACGTGCACATGGCGGCCGTTGGACAGTTCTTTTCGTCTCCCAAGCTTGGCCTA
CCCAAACACAGGGATCCGCGGTATATGCCCAACGTGATTGCGTCTCCAATGGTCAATGCGCCACCTTCAGATCTC
ATGGCCGACGTGATCAACAAGAGGAACAAGATGCATCATTTCGATAAGCAGACGGACGAAAACATGATTCCCCTC
TTCCGCCACGGGGTGGACGGCAAAGTAAGGAACAACGCGCACTTGCTGCCGCATAGAAATTGGTGCTCGATTAGC
TTGTGGACGCCAGGCAGCACGCCGCCACCGACGCCGCCGCATTCGTCGTATGAGGAGCGCCACAGCCCAGCGCCT
CATGCAAGCAGCAGCGGCGGCCTGCTTCGAAGATTTTCCTCAAGACGAAAGTCGGCGCCGCGGCGCATCGAGGGT
GGTCACGAGTCGGTTCGAGGGCCTCGGCCACCTATATCAGGGGGCATGGGCTTATTCCACAATATATCACGGCGG
CTATCCTGGTCAGACGGACAAGGCCTCATGCGCACCATGTCGCTGGGCCGCGGAGAGGGCAAGGATAGAGGATAT
TTGAACTATGCCTACAGAAACAGCGAGAGCCAGCCCGGCGGCGACGAGGGGGAGGTTGATGGCCACTGGCACACT
GATAGCTACGACGGCCTTGGGTCGGCTCCTGGGCGCGCTGCTCCTCCTCGCCCGTCTGGGCTGCGCGGTGGCGCC
CTGCACGAAGACGAGTACAAGGACGACGACGAATCCTACTTTAGCGCCTCGCACCCGGCCCGGCTAGCCCACACG
ACGGACAGCCTGCCGGGGCCGACGACGCATCTTGCCGACTCGCCGCCGCGGCGCGCATTTCACCGGACGCCAACG
GGCCTCTCGGCCAAGCAGCTGCGGCAGCCGGAGCGGTTCCAAGTGGACGTCGAGGGCGCACTCGAGGTGGTGCTC
AATATCGAGGTCAGCCCGCGCGACCCTGCCGGCATCACGGTGCCCTACCGCCTCCTCGTGCCGCGGCTGCAGTAC
GAGTACAACCCGTCGGAAGACGACATTGCCCTCAAGGAGCAGGCCGAGGGAAGCGCGTTGAAGCGTCTGCTTGGC
TTGGGGAAACGGACAGAAAAGGTGCGGTGCTATGAGCTCGAGGGCACCGAGACGGACGAGGCGGTGCATGGGTGA
Transcript >OphauG2|2969
ATGTCGGCCGCGCCGTACTGGGGCCAGCTGCCCGACGCAAAGACGGCCAAGGAGGCCCATGATGGCTTGCCATCC
GACCACGCCCATTCTATCCATGTTCCCCCGGTGCCGCGCCGCCCACGCCGCAACTCCATCGCAATGACTGATAGC
TACACCGACACCACCTTTAGCCCTCACACGCCTCTCACCCCCAGCTTTGGCCTCGCTCCTCGCCCGCTGTCCATT
CATCGCGGCCCCGATGCGCCTCCACAGAGCATGCCTCGCCCCAACAACCATTTCCCCCCCGTCTCTCACCCTGCT
GCTGCTCCGGATCCGCGAGGGCCGTCCCTCGGCCATCGTCCCGCCTACTCCAACGGCGATGCCCCCTATCCCCAT
CCGTCTGGCCCACCCAATGCTAGACCACGACCACAGCCCATTTACCAGGATCCGCGAGGAGACTTGGACTTTGGC
GTCGCCGTTAACTATGCCCCAAGGCGCGATGCCCCCCAAGAATCCTATCAGAGACCTATACACGACATGCAGCCT
CGCCTCGATCCACCACCCGCTGCCATAGAGGGCGCTGTGCAGCCCGAGCCACCCGTCGCAATGAGGCAATCAGAG
CGCCGCAGAAACATGACCAAGGAGGAAAAGAGAGCTAGAGTCGAAGCAGCTGAGCAGAGAGCTAGACAGCGAGCC
GACAAGGCCCACGACTCGCCAACTATCCCAAGCCAACAGGTGCCATCCGACCACCATTTTGTCTTTGCTGCGCGC
CGTCACCAAGCAGACACGGCCACCGAGCACCAGCCTGCTTCGCCTAGACTTCAAAGCAATGCTATGCCGCCCCAT
GGTGACTTGCCGCCCCAACGCCACCCGATTCCCCCTAACCGTGAACGACCCCAACGCACTTACAACAATCCCAGA
TTGGTGCCCGAGCAGCAAGCATCCCAGGATGGTGAGCCGACTGCAGCGACGTTTCCCCAACGAAATCTGAGCTTC
CGTGAGCGTGCTTCTACAAATGATGCACAGTCTCCCAGCTCTGCCCAAGTGCGACAACGCCCCTTTGCCAATACA
GAAGGCTATCCTCCTCCCCTCAACACAAACATACACAAGGTGAGAAAAGAGCCGCCGAGAGACTTTGAGTACCGC
CAGCAACTCTTGGGCAATCGATCGGTCTCGGGACCGGGCCCGCTTCTGACCGCGACACCTGCCCGTGTTAGAACC
TTGCCCGTGCCACTGCCGGACAAGCAACTAGCCCTAGCGCCCATGAATCCACCATTGGAAGCAGCAGCAATCCCA
GATAGTCATGTGGCCTCGCATCCGGCTTGGGCCTCGGACAAACAGCCGCCACCTCCTGCCTTGCAAGGGGTTCGA
CGACATGTCACTGAGCCCATCTACGCAAGGAAAGCCGACGTTGTTGTTGATCAAGCCTCGCCTTTAGAAAGAAAT
CAAATACATGACCAACCGCCAATCCAAGGCACTGCCGGCAGTGAGCAACTAGCCGCTCCTCAGCAAGACGCGCAC
AAGTCGTTGGAATACAAGGACCAGCTGGCAAGACAGGATAGCCCCGACATGTCAGATCAAGATGCCCGCAATGAG
CATTCTGGCGTCTTGAGGAGACAGGAGAGTTTGAAGCCGGGCGATGGCCTATACAAGGCACCAGAATGGCTCAGT
GAATGGAAGAGGGCAACAACAGGGCTACTTTCTGGTGCCCTGTTGGACATGGGCGACACACAACCTACTATAGGC
CCCGGCAGATACCCGCGCGACATGGGCGCTCGGGGGCCGAGCAGCACCTATTCATCGTCTCGCCGATGGAGAGCC
GAGGCTTTTGACGGAGAATATAAAGATGCCAATGCACCAACACGGTTCAAGCCGCCTTTGTATCTTAGCTGCGGT
CCGCTGTTGAGATACCGTGGCATTCGGCGAGAACGGTTTCCTACTAGGTCTCCCAGAGGCGACACCTCAGTGTCG
GAGCGAGAGATTTGGAGAGGTAGCATCATGATTGTGACCAAGGACTCGGATTCATCGTATGAGATATCGCCAACG
TTGCGTCTCTTTGTTCAGCAAGTCAAACTGCTACCTCCTCCACCTCACCAGATTAGGGGGGAGACACCGCCTGAA
TACGTAGATCCCATAGCTGGCCACCCCAAGTTGGGCCGATCCGGCGAGACGTTGTATGTGCGTCCAGTCGAGGAC
CTCGAAGAAGCCAGAGACCATTCTCTTGATGAAACGAACAAGGGAATTTTTGAGACGGCGAAGCAGACTGCAAAT
ATGCAGCCTGGAGATAGTGAAACGGATTGTCCAGGATCATTTACGAACCGCCGAAAGGCTATTGACATTGACGGC
GAAAAGCTGCAAAAGTTCAAGGATGTGAGAGGATTCCGTCTACACGCCGAACGAGGGTGTACCTTTTGGAGGTTC
AACATTGAAGTGGAGCTACGAGACGAGCAACAGCGCATTGCATACCGCATCAATCGCGGACCCTCCATGGGCTTT
TGGGTGCCGCCGCGGGGTGAGGCTATGAACATCATGTTCTACAGCTGCAACGGCTTTAGTCCCAATGTCAAGACG
GACGAGCTGAGCGGACCGGATCCCATGTGGAGAGACGTACTCAACTCGCATCAGTCGCGCCCGTTTCATGTCATG
ATTGGAGGCGGCGACCAAATTTACAATGATCGACTGGCGTACAACAGTCCTCTATTTGATGGTTGGCTGGAAGAG
AGGGATCCGCACGAGAAGCGCAACGCACCCTTCAGCGCAGCAATGCAGGACGAGCTCGAGGCTTTTTACTTGGAG
CGGTATTGCACATGGTTCTCTCAGGGTCTCTTTGGGCTGGCCGTGTCTCAGATACCCATGGTCAACATGTACGAC
AACCATGACGTCTTTGACGGCTATGGCTCGTACCCGCATCTCAACATGGCCTCGCCCGTCTTTTGTGGACTCGGA
GCTGTGGCATTCAAATACTATATGCTCTTTCAACATCAGAGCCTGGTAACCGAAACGGAAAAGTCGGAGCCAAGC
TGGATCTTGGGTGTGGAACCCGGGCCATACATGAAGGAGCTCAGCCATAGCGTCTATGTATCTCTGGGAGGCAAA
GTGGCATTGCTGGCTGTTGACTGTCGCACCGAGAGAACAGAGTCCGAGGTTGTTCGAGAGAAGACGTGGGAAAAG
ATGATGAATCGCATGTACTCGGAGATTAGACGGGGGCAGATGGAGCATCTCTTGTTGGTTCTGGGAACGCCCATT
GCCTATCCTCGGCTTGTCTGGCTGGAAAACATTTTGACATCGAGGCTCATGGGCCCGGTCAAGGCGCTGGGCAAA
ACGGGCATGCTAGGCAAAGCCATGAATGATATCGACGGCGGTGCTGACGCGCGAGACGACCTGAACGAGCACTGG
ACGGCCAAGAAGCACAAGCAAGAACGTAGTCTTATTATTGAGGACTTGCAGGATCTCGCCATTGACAAGTCTTTG
CGCATCACGATTCTCAGCGGCGACGTGCACATGGCGGCCGTTGGACAGTTCTTTTCGTCTCCCAAGCTTGGCCTA
CCCAAACACAGGGATCCGCGGTATATGCCCAACGTGATTGCGTCTCCAATGGTCAATGCGCCACCTTCAGATCTC
ATGGCCGACGTGATCAACAAGAGGAACAAGATGCATCATTTCGATAAGCAGACGGACGAAAACATGATTCCCCTC
TTCCGCCACGGGGTGGACGGCAAAGTAAGGAACAACGCGCACTTGCTGCCGCATAGAAATTGGTGCTCGATTAGC
TTGTGGACGCCAGGCAGCACGCCGCCACCGACGCCGCCGCATTCGTCGTATGAGGAGCGCCACAGCCCAGCGCCT
CATGCAAGCAGCAGCGGCGGCCTGCTTCGAAGATTTTCCTCAAGACGAAAGTCGGCGCCGCGGCGCATCGAGGGT
GGTCACGAGTCGGTTCGAGGGCCTCGGCCACCTATATCAGGGGGCATGGGCTTATTCCACAATATATCACGGCGG
CTATCCTGGTCAGACGGACAAGGCCTCATGCGCACCATGTCGCTGGGCCGCGGAGAGGGCAAGGATAGAGGATAT
TTGAACTATGCCTACAGAAACAGCGAGAGCCAGCCCGGCGGCGACGAGGGGGAGGTTGATGGCCACTGGCACACT
GATAGCTACGACGGCCTTGGGTCGGCTCCTGGGCGCGCTGCTCCTCCTCGCCCGTCTGGGCTGCGCGGTGGCGCC
CTGCACGAAGACGAGTACAAGGACGACGACGAATCCTACTTTAGCGCCTCGCACCCGGCCCGGCTAGCCCACACG
ACGGACAGCCTGCCGGGGCCGACGACGCATCTTGCCGACTCGCCGCCGCGGCGCGCATTTCACCGGACGCCAACG
GGCCTCTCGGCCAAGCAGCTGCGGCAGCCGGAGCGGTTCCAAGTGGACGTCGAGGGCGCACTCGAGGTGGTGCTC
AATATCGAGGTCAGCCCGCGCGACCCTGCCGGCATCACGGTGCCCTACCGCCTCCTCGTGCCGCGGCTGCAGTAC
GAGTACAACCCGTCGGAAGACGACATTGCCCTCAAGGAGCAGGCCGAGGGAAGCGCGTTGAAGCGTCTGCTTGGC
TTGGGGAAACGGACAGAAAAGGTGCGGTGCTATGAGCTCGAGGGCACCGAGACGGACGAGGCGGTGCATGGGTGA
Gene >OphauG2|2969
ATGTCGGCCGCGCCGTACTGGGGCCAGCTGCCCGACGCAAAGACGGCCAAGGAGGCCCATGATGGCTTGCCATCC
GACCACGCCCATTCTATCCATGTTCCCCCGGTGCCGCGCCGCCCACGCCGCAACTCCATCGCAATGACTGATAGC
TACACCGACACCACCTTTAGCCCTCACACGCCTCTCACCCCCAGCTTTGGCCTCGCTCCTCGCCCGCTGTCCATT
CATCGCGGCCCCGATGCGCCTCCACAGAGCATGCCTCGCCCCAACAACCATTTCCCCCCCGTCTCTCACCCTGCT
GCTGCTCCGGATCCGCGAGGGCCGTCCCTCGGCCATCGTCCCGCCTACTCCAACGGCGATGCCCCCTATCCCCAT
CCGTCTGGCCCACCCAATGCTAGACCACGACCACAGCCCATTTACCAGGATCCGCGAGGAGACTTGGACTTTGGC
GTCGCCGTTAACTATGCCCCAAGGCGCGATGCCCCCCAAGAATCCTATCAGAGACCTATACACGACATGCAGCCT
CGCCTCGATCCACCACCCGCTGCCATAGAGGGCGCTGTGCAGCCCGAGCCACCCGTCGCAATGAGGCAATCAGAG
CGCCGCAGAAAGTTGGCAACCGAACGATCTCCGCTTCAGAAGCTTGAACTGACGCTCGATAGCATGACCAAGGAG
GAAAAGAGAGCTAGAGTCGAAGCAGCTGAGCAGAGAGCTAGACAGCGAGCCGACAAGGCCCACGACTCGCCAACT
ATCCCAAGCCAACAGGTGCCATCCGACCACCATTTTGTCTTTGCTGCGCGCCGTCACCAAGCAGACACGGCCACC
GAGCACCAGCCTGCTTCGCCTAGACTTCAAAGCAATGCTATGCCGCCCCATGGTGACTTGCCGCCCCAACGCCAC
CCGATTCCCCCTAACCGTGAACGACCCCAACGCACTTACAACAATCCCAGATTGGTGCCCGAGCAGCAAGCATCC
CAGGATGGTGAGCCGACTGCAGCGACGTTTCCCCAACGAAATCTGAGCTTCCGTGAGCGTGCTTCTACAAATGAT
GCACAGTCTCCCAGCTCTGCCCAAGTGCGACAACGCCCCTTTGCCAATACAGAAGGCTATCCTCCTCCCCTCAAC
ACAAACATACACAAGGTGAGAAAAGAGCCGCCGAGAGACTTTGAGTACCGCCAGCAACTCTTGGGCAATCGATCG
GTCTCGGGACCGGGCCCGCTTCTGACCGCGACACCTGCCCGTGTTAGAACCTTGCCCGTGCCACTGCCGGACAAG
CAACTAGCCCTAGCGCCCATGAATCCACCATTGGAAGCAGCAGCAATCCCAGATAGTCATGTGGCCTCGCATCCG
GCTTGGGCCTCGGACAAACAGCCGCCACCTCCTGCCTTGCAAGGGGTTCGACGACATGTCACTGAGCCCATCTAC
GCAAGGAAAGCCGACGTTGTTGTTGATCAAGCCTCGCCTTTAGAAAGAAATCAAATACATGACCAACCGCCAATC
CAAGGCACTGCCGGCAGTGAGCAACTAGCCGCTCCTCAGCAAGACGCGCACAAGTCGTTGGAATACAAGGACCAG
CTGGCAAGACAGGATAGCCCCGACATGTCAGATCAAGATGCCCGCAATGAGCATTCTGGCGTCTTGAGGAGACAG
GAGAGTTTGAAGCCGGGCGATGGCCTATACAAGGCACCAGAATGGCTCAGTGAATGGAAGAGGGCAACAACAGGG
CTACTTTCTGGTGCCCTGTTGGACATGGGCGACACACAACCTACTATAGGCCCCGGCAGATACCCGCGCGACATG
GGCGCTCGGGGGCCGAGCAGCACCTATTCATCGTCTCGCCGATGGAGAGCCGAGGCTTTTGACGGAGAATATAAA
GATGCCAATGGTGAGTTGTTGCAGCCACGTGATTTCAACAACAAAGACTATATTGACAAGCATTGCCAGCACCAA
CACGGTTCAAGCCGCCTTTGTATCTTAGCTGCGGTCCGCTGTTGAGATACCGTGGCATTCGGCGAGAACGGTTTC
CTACTAGGTCTCCCAGAGGCGACACCTCAGTGTCGGAGCGAGAGATTTGGAGAGGTAGCATCATGATTGTGACCA
AGGACTCGGATTCATCGTATGAGATATCGCCAACGTTGCGTCTCTTTGTTCAGCAAGTCAAACTGCTACCTCCTC
CACCTCACCAGATTAGGGGGGAGACACCGCCTGAATACGTAGATCCCATAGCTGGCCACCCCAAGTTGGGCCGAT
CCGGCGAGACGTTGTATGTGCGTCCAGTCGAGGACCTCGAAGAAGCCAGAGACCATTCTCTTGATGAAACGAACA
AGGGAATTTTTGAGACGGCGAAGCAGACTGCAAATATGCAGCCTGGAGATAGTGAAACGGATTGTCCAGGATCAT
TTACGAACCGCCGAAAGGCTATTGACATTGACGGCGAAAAGCTGCAAAAGTTCAAGGATGTGAGAGGATTCCGTC
TACACGCCGAACGAGGGTGTACCTTTTGGAGGTTCAACATTGAAGTGGAGCTACGAGACGAGCAACAGCGCATTG
CATACCGCATCAATCGCGGACCCTCCATGGGCTTTTGGGTGCCGCCGCGGGGTGAGGCTATGAACATCATGTTCT
ACAGCTGCAACGGCTTTAGTCCCAATGTCAAGACGGACGAGCTGAGCGGACCGGATCCCATGTGGAGAGACGTAC
TCAACTCGCATCAGTCGCGCCCGTTTCATGTCATGATTGGAGGCGGCGACCAAATTTACAATGATCGACTGGCGT
ACAACAGTCCTCTATTTGATGGTTGGCTGGAAGAGAGGGATCCGCACGAGAAGCGCAACGCACCCTTCAGCGCAG
CAATGCAGGACGAGCTCGAGGCTTTTTACTTGGAGCGGTATTGCACATGGTTCTCTCAGGGTCTCTTTGGGCTGG
CCGTGTCTCAGATACCCATGGTCAACATGTACGACAACCATGACGTCTTTGACGGCTATGGCTCGTACCCGCATC
TCAACATGGCCTCGCCCGTCTTTTGTGGACTCGGAGCTGTGGCATTCAAATACTATATGCTCTTTCAACATCAGA
GCCTGGTAACCGAAACGGAAAAGTCGGAGCCAAGCTGGATCTTGGGTGTGGAACCCGGGCCATACATGAAGGAGC
TCAGCCATAGCGTCTATGTATCTCTGGGAGGCAAAGTGGCATTGCTGGCTGTTGACTGTCGCACCGAGAGAACAG
AGTCCGAGGTTGTTCGAGAGAAGACGTGGGAAAAGATGATGAATCGCATGTACTCGGAGATTAGACGGGGGCAGA
TGGAGCATCTCTTGTTGGTTCTGGGAACGCCCATTGCCTATCCTCGGCTTGTCTGGCTGGAAAACATGTGAGTAA
TGGTCTGGTGCTGGCGCCGCGCAACAAGAAGGGGTATTGCATGGCGCTTGCTAACAAGCATGTACGCAGTTTGAC
ATCGAGGCTCATGGGCCCGGTCAAGGCGCTGGGCAAAACGGGCATGCTAGGCAAAGCCATGAATGATATCGACGG
CGGTGCTGACGCGCGAGACGACCTGAACGAGCACTGGACGGCCAAGAAGCACAAGCAAGAACGTAGTCTTATTAT
TGAGGACTTGCAGGATCTCGCCATTGACAAGTCTTTGCGCATCACGATTCTCAGGTAGGACAAGGCAGGCGCCTG
ATTATTTGTCCATGACTAGTAGCTAATGTTTTGGACAGCGGCGACGTGCACATGGCGGCCGTTGGACAGTTCTTT
TCGTCTCCCAAGCTTGGCCTACCCAAACACAGGGATCCGCGGTATATGCCCAACGTGATTGCGTCTCCAATGGTC
AATGCGCCACCTTCAGATCTCATGGCCGACGTGATCAACAAGAGGAACAAGATGCATCATTTCGATAAGCAGACG
GACGAAAACATGATTCCCCTCTTCCGCCACGGGGTGGACGGCAAAGTAAGGAACAACGCGCACTTGCTGCCGCAT
AGAAATTGGTGCTCGATTAGCTTGTGGACGCCAGGCAGCACGCCGCCACCGACGCCGCCGCATTCGTCGTATGAG
GAGCGCCACAGCCCAGCGCCTCATGCAAGCAGCAGCGGCGGCCTGCTTCGAAGATTTTCCTCAAGACGAAAGTCG
GCGCCGCGGCGCATCGAGGGTGGTCACGAGTCGGTTCGAGGGCCTCGGCCACCTATATCAGGGGGCATGGGCTTA
TTCCACAATATATCACGGCGGCTATCCTGGTCAGACGGACAAGGCCTCATGCGCACCATGTCGCTGGGCCGCGGA
GAGGGCAAGGATAGAGGATATTTGAACTATGCCTACAGAAACAGCGAGAGCCAGCCCGGCGGCGACGAGGGGGAG
GTTGATGGCCACTGGCACACTGATAGCTACGACGGCCTTGGGTCGGCTCCTGGGCGCGCTGCTCCTCCTCGCCCG
TCTGGGCTGCGCGGTGGCGCCCTGCACGAAGACGAGTACAAGGACGACGACGAATCCTACTTTAGCGCCTCGCAC
CCGGCCCGGCTAGCCCACACGACGGACAGCCTGCCGGGGCCGACGACGCATCTTGCCGACTCGCCGCCGCGGCGC
GCATTTCACCGGACGCCAACGGGCCTCTCGGCCAAGCAGCTGCGGCAGCCGGAGCGGTTCCAAGTGGACGTCGAG
GGCGCACTCGAGGTGGTGCTCAATATCGAGGTCAGCCCGCGCGACCCTGCCGGCATCACGGTGCCCTACCGCCTC
CTCGTGCCGCGGCTGCAGTACGAGTACAACCCGTCGGAAGACGACATTGCCCTCAAGGAGCAGGCCGAGGGAAGC
GCGTTGAAGCGTCTGCTTGGCTTGGGGAAACGGACAGAAAAGGTGCGGTGCTATGAGCTCGAGGGCACCGAGACG
GACGAGGCGGTGCATGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail