Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2956
Gene name
LocationContig_217:8414..10476
Strand-
Gene length (bp)2062
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 1.9E-11 126 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 7 402 8.0E-22
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 7 402 1.0E-21
sp|Q9CZJ2|HS12B_MOUSE Heat shock 70 kDa protein 12B OS=Mus musculus GN=Hspa12b PE=1 SV=1 7 397 7.0E-18
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 7 402 2.0E-17
sp|Q4L6T0|DNAK_STAHJ Chaperone protein DnaK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dnaK PE=3 SV=1 8 367 8.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 7 402 8.0E-22
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 7 402 1.0E-21
sp|Q9CZJ2|HS12B_MOUSE Heat shock 70 kDa protein 12B OS=Mus musculus GN=Hspa12b PE=1 SV=1 7 397 7.0E-18
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 7 402 2.0E-17
sp|Q4L6T0|DNAK_STAHJ Chaperone protein DnaK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dnaK PE=3 SV=1 8 367 8.0E-12
sp|P64408|DNAK_STAAW Chaperone protein DnaK OS=Staphylococcus aureus (strain MW2) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|A8Z4B9|DNAK_STAAT Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|Q6G8Y7|DNAK_STAAS Chaperone protein DnaK OS=Staphylococcus aureus (strain MSSA476) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|Q6GGC0|DNAK_STAAR Chaperone protein DnaK OS=Staphylococcus aureus (strain MRSA252) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|P99110|DNAK_STAAN Chaperone protein DnaK OS=Staphylococcus aureus (strain N315) GN=dnaK PE=1 SV=1 8 367 1.0E-11
sp|P64407|DNAK_STAAM Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|A6QHC3|DNAK_STAAE Chaperone protein DnaK OS=Staphylococcus aureus (strain Newman) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|Q5HFI0|DNAK_STAAC Chaperone protein DnaK OS=Staphylococcus aureus (strain COL) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|A5ITA8|DNAK_STAA9 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH9) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|Q2FXZ2|DNAK_STAA8 Chaperone protein DnaK OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|Q2FGE3|DNAK_STAA3 Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|A6U252|DNAK_STAA2 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH1) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|A7X2Y1|DNAK_STAA1 Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|P45554|DNAK_STAAU Chaperone protein DnaK OS=Staphylococcus aureus GN=dnaK PE=3 SV=1 8 367 1.0E-11
sp|A6LM32|DNAK_THEM4 Chaperone protein DnaK OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaK PE=3 SV=1 1 366 2.0E-11
sp|B9DNK0|DNAK_STACT Chaperone protein DnaK OS=Staphylococcus carnosus (strain TM300) GN=dnaK PE=3 SV=1 8 367 2.0E-11
sp|Q1WUE8|DNAK_LACS1 Chaperone protein DnaK OS=Lactobacillus salivarius (strain UCC118) GN=dnaK PE=3 SV=1 8 367 2.0E-11
sp|B5E232|DNAK_STRP4 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dnaK PE=3 SV=1 8 367 4.0E-11
sp|Q2YT47|DNAK_STAAB Chaperone protein DnaK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaK PE=3 SV=1 8 367 8.0E-11
sp|Q8Y0L9|HSCA_RALSO Chaperone protein HscA homolog OS=Ralstonia solanacearum (strain GMI1000) GN=hscA PE=3 SV=1 4 328 1.0E-10
sp|B1L9B4|DNAK_THESQ Chaperone protein DnaK OS=Thermotoga sp. (strain RQ2) GN=dnaK PE=3 SV=1 1 329 1.0E-10
sp|A5IK42|DNAK_THEP1 Chaperone protein DnaK OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaK PE=3 SV=1 1 329 1.0E-10
sp|Q9WYK6|DNAK_THEMA Chaperone protein DnaK OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaK PE=3 SV=1 1 329 1.0E-10
sp|A3CQC2|DNAK_STRSV Chaperone protein DnaK OS=Streptococcus sanguinis (strain SK36) GN=dnaK PE=3 SV=1 8 367 2.0E-10
sp|B1HUD1|DNAK_LYSSC Chaperone protein DnaK OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaK PE=3 SV=1 8 340 2.0E-10
sp|Q8CP17|DNAK_STAES Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaK PE=3 SV=1 8 328 2.0E-10
sp|O69268|DNAK_LYSSH Chaperone protein DnaK OS=Lysinibacillus sphaericus GN=dnaK PE=3 SV=3 8 340 2.0E-10
sp|Q5HNW6|DNAK_STAEQ Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaK PE=3 SV=1 8 328 3.0E-10
sp|B9KBT4|DNAK_THENN Chaperone protein DnaK OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaK PE=3 SV=1 1 329 3.0E-10
sp|Q6KIH7|DNAK_MYCMO Chaperone protein DnaK OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaK PE=3 SV=1 8 204 4.0E-10
sp|B7ID00|DNAK_THEAB Chaperone protein DnaK OS=Thermosipho africanus (strain TCF52B) GN=dnaK PE=3 SV=1 1 329 4.0E-10
sp|P64409|DNAK_TROWT Chaperone protein DnaK OS=Tropheryma whipplei (strain Twist) GN=dnaK PE=3 SV=1 9 328 4.0E-10
sp|P64410|DNAK_TROW8 Chaperone protein DnaK OS=Tropheryma whipplei (strain TW08/27) GN=dnaK PE=3 SV=1 9 328 4.0E-10
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 9 367 5.0E-10
sp|B2G6W3|DNAK_LACRJ Chaperone protein DnaK OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaK PE=3 SV=1 8 367 5.0E-10
sp|A5VJE7|DNAK_LACRD Chaperone protein DnaK OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaK PE=3 SV=1 8 367 5.0E-10
sp|B8DYH6|DNAK_DICTD Chaperone protein DnaK OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=dnaK PE=3 SV=1 8 204 7.0E-10
sp|Q03WI2|DNAK_LEUMM Chaperone protein DnaK OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dnaK PE=3 SV=1 8 204 9.0E-10
sp|Q49Y22|DNAK_STAS1 Chaperone protein DnaK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaK PE=3 SV=1 8 367 9.0E-10
sp|B5YAR3|DNAK_DICT6 Chaperone protein DnaK OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaK PE=3 SV=1 8 204 1.0E-09
sp|Q9JUF4|HSCA_NEIMA Chaperone protein HscA homolog OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hscA PE=3 SV=1 6 339 1.0E-09
sp|A9KKU0|DNAK_CLOPH Chaperone protein DnaK OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaK PE=3 SV=1 8 340 1.0E-09
sp|A8FFD2|DNAK_BACP2 Chaperone protein DnaK OS=Bacillus pumilus (strain SAFR-032) GN=dnaK PE=3 SV=1 8 328 1.0E-09
sp|Q74IT6|DNAK_LACJO Chaperone protein DnaK OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaK PE=3 SV=1 8 367 2.0E-09
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 92 328 3.0E-09
sp|P0A3J0|DNAK_LACLA Chaperone protein DnaK OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dnaK PE=3 SV=1 8 204 3.0E-09
sp|B9E6X1|DNAK_MACCJ Chaperone protein DnaK OS=Macrococcus caseolyticus (strain JCSC5402) GN=dnaK PE=3 SV=1 8 204 3.0E-09
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 8 366 3.0E-09
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 8 328 4.0E-09
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 92 366 4.0E-09
sp|C3L3G7|DNAK_CLOB6 Chaperone protein DnaK OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dnaK PE=3 SV=1 8 366 5.0E-09
sp|A7GHH6|DNAK_CLOBL Chaperone protein DnaK OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dnaK PE=3 SV=1 8 366 5.0E-09
sp|C1FVU0|DNAK_CLOBJ Chaperone protein DnaK OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dnaK PE=3 SV=1 8 366 5.0E-09
sp|A5I640|DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dnaK PE=3 SV=1 8 366 5.0E-09
sp|A7FXL5|DNAK_CLOB1 Chaperone protein DnaK OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dnaK PE=3 SV=1 8 366 5.0E-09
sp|B1KZN7|DNAK_CLOBM Chaperone protein DnaK OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dnaK PE=3 SV=1 8 366 6.0E-09
sp|Q4A658|DNAK_MYCS5 Chaperone protein DnaK OS=Mycoplasma synoviae (strain 53) GN=dnaK PE=3 SV=1 5 199 6.0E-09
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 92 367 6.0E-09
sp|B1ILM3|DNAK_CLOBK Chaperone protein DnaK OS=Clostridium botulinum (strain Okra / Type B1) GN=dnaK PE=3 SV=1 8 366 6.0E-09
sp|Q044A9|DNAK_LACGA Chaperone protein DnaK OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaK PE=3 SV=1 8 367 6.0E-09
sp|A0AIS4|DNAK_LISW6 Chaperone protein DnaK OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaK PE=3 SV=1 8 328 7.0E-09
sp|B1YKS9|DNAK_EXIS2 Chaperone protein DnaK OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dnaK PE=3 SV=1 8 367 7.0E-09
sp|B1MZG6|DNAK_LEUCK Chaperone protein DnaK OS=Leuconostoc citreum (strain KM20) GN=dnaK PE=3 SV=1 8 204 7.0E-09
sp|P17820|DNAK_BACSU Chaperone protein DnaK OS=Bacillus subtilis (strain 168) GN=dnaK PE=1 SV=3 8 367 7.0E-09
sp|Q6AC76|DNAK_LEIXX Chaperone protein DnaK OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaK PE=3 SV=1 9 328 8.0E-09
sp|B3WEQ7|DNAK_LACCB Chaperone protein DnaK OS=Lactobacillus casei (strain BL23) GN=dnaK PE=3 SV=1 8 199 9.0E-09
sp|Q038N3|DNAK_LACC3 Chaperone protein DnaK OS=Lactobacillus casei (strain ATCC 334) GN=dnaK PE=3 SV=1 8 199 9.0E-09
sp|B0RBI1|DNAK_CLAMS Chaperone protein DnaK OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=dnaK PE=3 SV=1 9 328 1.0E-08
sp|B2GBQ5|DNAK_LACF3 Chaperone protein DnaK OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaK PE=3 SV=1 8 204 1.0E-08
sp|A5CM86|DNAK_CLAM3 Chaperone protein DnaK OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=dnaK PE=3 SV=1 9 328 1.0E-08
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 8 204 1.0E-08
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 8 204 1.0E-08
sp|Q9JS04|HSCA_NEIMB Chaperone protein HscA homolog OS=Neisseria meningitidis serogroup B (strain MC58) GN=hscA PE=3 SV=1 6 339 1.0E-08
sp|A7Z6W1|DNAK_BACMF Chaperone protein DnaK OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaK PE=3 SV=1 8 204 1.0E-08
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 92 367 1.0E-08
sp|Q67S54|DNAK_SYMTH Chaperone protein DnaK OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaK PE=3 SV=1 8 256 1.0E-08
sp|Q84BU4|DNAK_LACAC Chaperone protein DnaK OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaK PE=3 SV=1 8 199 1.0E-08
sp|A5N6M2|DNAK_CLOK5 Chaperone protein DnaK OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaK PE=3 SV=1 8 328 2.0E-08
sp|B9E041|DNAK_CLOK1 Chaperone protein DnaK OS=Clostridium kluyveri (strain NBRC 12016) GN=dnaK PE=3 SV=1 8 328 2.0E-08
sp|A4XKA4|DNAK_CALS8 Chaperone protein DnaK OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaK PE=3 SV=1 8 328 2.0E-08
sp|P05646|DNAK_BACME Chaperone protein DnaK OS=Bacillus megaterium GN=dnaK PE=3 SV=3 8 328 2.0E-08
sp|A6LRN4|DNAK_CLOB8 Chaperone protein DnaK OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaK PE=3 SV=1 8 328 2.0E-08
sp|Q049W6|DNAK_LACDB Chaperone protein DnaK OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaK PE=3 SV=1 8 367 2.0E-08
sp|Q1G9R2|DNAK_LACDA Chaperone protein DnaK OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaK PE=3 SV=1 8 367 2.0E-08
sp|Q8K9Y8|DNAK_BUCAP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaK PE=3 SV=1 8 367 2.0E-08
sp|Q45551|DNAK_GEOSE Chaperone protein DnaK OS=Geobacillus stearothermophilus GN=dnaK PE=3 SV=2 8 328 2.0E-08
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 92 367 2.0E-08
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 8 367 2.0E-08
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 8 256 2.0E-08
sp|C5D4U1|DNAK_GEOSW Chaperone protein DnaK OS=Geobacillus sp. (strain WCH70) GN=dnaK PE=3 SV=1 8 328 2.0E-08
sp|Q9KWS7|DNAK_GEOTM Chaperone protein DnaK OS=Geobacillus thermoglucosidasius GN=dnaK PE=3 SV=3 8 328 3.0E-08
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 8 366 3.0E-08
sp|Q892R0|DNAK_CLOTE Chaperone protein DnaK OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaK PE=3 SV=1 8 239 3.0E-08
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 8 328 3.0E-08
sp|A2BZ91|DNAK_PROM5 Chaperone protein DnaK OS=Prochlorococcus marinus (strain MIT 9515) GN=dnaK PE=3 SV=1 8 204 3.0E-08
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 8 367 3.0E-08
sp|P0DJM2|DNAK_LISMO Chaperone protein DnaK OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaK PE=3 SV=1 8 328 3.0E-08
sp|G2K046|DNAK_LISM4 Chaperone protein DnaK OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaK PE=3 SV=1 8 328 3.0E-08
sp|B2U8U5|HSCA_RALPJ Chaperone protein HscA homolog OS=Ralstonia pickettii (strain 12J) GN=hscA PE=3 SV=1 4 339 3.0E-08
sp|Q71ZJ7|DNAK_LISMF Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaK PE=3 SV=3 8 328 3.0E-08
sp|C1KVC0|DNAK_LISMC Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaK PE=3 SV=1 8 328 3.0E-08
sp|Q5WHG1|DNAK_BACSK Chaperone protein DnaK OS=Bacillus clausii (strain KSM-K16) GN=dnaK PE=3 SV=1 8 204 3.0E-08
sp|B8DE38|DNAK_LISMH Chaperone protein DnaK OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaK PE=3 SV=1 8 328 3.0E-08
sp|Q98QY7|DNAK_MYCPU Chaperone protein DnaK OS=Mycoplasma pulmonis (strain UAB CTIP) GN=dnaK PE=3 SV=1 5 204 3.0E-08
sp|Q92BN8|DNAK_LISIN Chaperone protein DnaK OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaK PE=3 SV=3 8 328 3.0E-08
sp|B8FUN4|DNAK_DESHD Chaperone protein DnaK OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaK PE=3 SV=1 8 328 3.0E-08
sp|Q03QU1|DNAK_LACBA Chaperone protein DnaK OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaK PE=3 SV=1 8 204 4.0E-08
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 9 366 4.0E-08
sp|Q182E8|DNAK_PEPD6 Chaperone protein DnaK OS=Peptoclostridium difficile (strain 630) GN=dnaK PE=3 SV=1 8 204 4.0E-08
sp|A8YVQ3|DNAK_LACH4 Chaperone protein DnaK OS=Lactobacillus helveticus (strain DPC 4571) GN=dnaK PE=3 SV=1 8 199 4.0E-08
sp|B1YT24|HSCA_BURA4 Chaperone protein HscA homolog OS=Burkholderia ambifaria (strain MC40-6) GN=hscA PE=3 SV=1 4 343 4.0E-08
sp|A5IXT5|DNAK_MYCAP Chaperone protein DnaK OS=Mycoplasma agalactiae (strain PG2) GN=dnaK PE=3 SV=1 5 199 5.0E-08
sp|Q6HDK7|DNAK_BACHK Chaperone protein DnaK OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|Q634M7|DNAK_BACCZ Chaperone protein DnaK OS=Bacillus cereus (strain ZK / E33L) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|Q818E9|DNAK_BACCR Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|B7HCU0|DNAK_BACC4 Chaperone protein DnaK OS=Bacillus cereus (strain B4264) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|C1ESK8|DNAK_BACC3 Chaperone protein DnaK OS=Bacillus cereus (strain 03BB102) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|B7JN39|DNAK_BACC0 Chaperone protein DnaK OS=Bacillus cereus (strain AH820) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|Q81LS2|DNAK_BACAN Chaperone protein DnaK OS=Bacillus anthracis GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|A0RIT3|DNAK_BACAH Chaperone protein DnaK OS=Bacillus thuringiensis (strain Al Hakam) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|C3L5R7|DNAK_BACAC Chaperone protein DnaK OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|C3P8M0|DNAK_BACAA Chaperone protein DnaK OS=Bacillus anthracis (strain A0248) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|B7IYG7|DNAK_BACC2 Chaperone protein DnaK OS=Bacillus cereus (strain G9842) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|P75344|DNAK_MYCPN Chaperone protein DnaK OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaK PE=3 SV=1 1 367 5.0E-08
sp|B9IY81|DNAK_BACCQ Chaperone protein DnaK OS=Bacillus cereus (strain Q1) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|B7HPL3|DNAK_BACC7 Chaperone protein DnaK OS=Bacillus cereus (strain AH187) GN=dnaK PE=3 SV=1 8 204 5.0E-08
sp|Q65H54|DNAK_BACLD Chaperone protein DnaK OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaK PE=3 SV=1 8 367 6.0E-08
sp|Q730M1|DNAK_BACC1 Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaK PE=3 SV=1 8 204 6.0E-08
sp|A0Q1R4|DNAK_CLONN Chaperone protein DnaK OS=Clostridium novyi (strain NT) GN=dnaK PE=3 SV=1 8 328 6.0E-08
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 8 341 6.0E-08
sp|Q7MA35|DNAK_WOLSU Chaperone protein DnaK OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaK PE=3 SV=1 8 367 7.0E-08
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 8 204 7.0E-08
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 44 367 7.0E-08
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 92 367 7.0E-08
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 8 204 8.0E-08
sp|B8I305|DNAK_CLOCE Chaperone protein DnaK OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaK PE=3 SV=1 8 204 8.0E-08
sp|A9IQZ6|HSCA_BORPD Chaperone protein HscA homolog OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hscA PE=3 SV=1 4 328 1.0E-07
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 8 367 1.0E-07
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 1 367 1.0E-07
sp|Q0KCG7|HSCA_CUPNH Chaperone protein HscA homolog OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hscA PE=3 SV=1 4 341 1.0E-07
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 44 367 1.0E-07
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 92 367 1.0E-07
sp|C4Z1J4|DNAK_EUBE2 Chaperone protein DnaK OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=dnaK PE=3 SV=1 8 204 1.0E-07
sp|Q5F8E8|HSCA_NEIG1 Chaperone protein HscA homolog OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hscA PE=3 SV=1 129 339 1.0E-07
sp|Q15WH0|HSCA_PSEA6 Chaperone protein HscA homolog OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hscA PE=3 SV=1 4 339 1.0E-07
sp|A0K8P6|HSCA_BURCH Chaperone protein HscA homolog OS=Burkholderia cenocepacia (strain HI2424) GN=hscA PE=3 SV=1 4 343 1.0E-07
sp|Q1BHT5|HSCA_BURCA Chaperone protein HscA homolog OS=Burkholderia cenocepacia (strain AU 1054) GN=hscA PE=3 SV=1 4 343 1.0E-07
sp|Q5PAB8|DNAK_ANAMM Chaperone protein DnaK OS=Anaplasma marginale (strain St. Maries) GN=dnaK PE=3 SV=1 1 367 1.0E-07
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 8 367 1.0E-07
sp|B3R475|HSCA_CUPTR Chaperone protein HscA homolog OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=hscA PE=3 SV=1 4 341 2.0E-07
sp|B1JV00|HSCA_BURCC Chaperone protein HscA homolog OS=Burkholderia cenocepacia (strain MC0-3) GN=hscA PE=3 SV=1 4 343 2.0E-07
sp|B4EDS3|HSCA_BURCJ Chaperone protein HscA homolog OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hscA PE=3 SV=1 4 343 2.0E-07
sp|Q1H365|HSCA_METFK Chaperone protein HscA homolog OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hscA PE=3 SV=1 4 341 2.0E-07
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 8 366 2.0E-07
sp|Q313S2|DNAK_DESAG Chaperone protein DnaK OS=Desulfovibrio alaskensis (strain G20) GN=dnaK PE=3 SV=1 8 367 2.0E-07
sp|Q0RBC4|DNAK_FRAAA Chaperone protein DnaK OS=Frankia alni (strain ACN14a) GN=dnaK PE=3 SV=1 9 247 2.0E-07
sp|A6SXE9|HSCA_JANMA Chaperone protein HscA homolog OS=Janthinobacterium sp. (strain Marseille) GN=hscA PE=3 SV=1 4 280 2.0E-07
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 92 367 2.0E-07
sp|A0LWS7|DNAK_ACIC1 Chaperone protein DnaK OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=dnaK PE=3 SV=1 9 328 2.0E-07
sp|Q9ZEJ6|DNAK1_NOSS1 Chaperone protein dnaK1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK1 PE=3 SV=2 8 366 2.0E-07
sp|Q6G1F9|DNAK_BARQU Chaperone protein DnaK OS=Bartonella quintana (strain Toulouse) GN=dnaK PE=3 SV=1 44 367 2.0E-07
sp|Q5NYT1|HSCA_AROAE Chaperone protein HscA homolog OS=Aromatoleum aromaticum (strain EbN1) GN=hscA PE=3 SV=1 129 339 2.0E-07
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 98 366 3.0E-07
sp|P47547|DNAK_MYCGE Chaperone protein DnaK OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaK PE=3 SV=1 1 367 3.0E-07
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 44 367 3.0E-07
sp|B8IHL3|DNAK_METNO Chaperone protein DnaK OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaK PE=3 SV=1 8 340 3.0E-07
sp|Q47HK2|DNAK_DECAR Chaperone protein DnaK OS=Dechloromonas aromatica (strain RCB) GN=dnaK PE=3 SV=1 8 478 3.0E-07
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 85 367 3.0E-07
sp|Q9LDZ0|HSP7J_ARATH Heat shock 70 kDa protein 10, mitochondrial OS=Arabidopsis thaliana GN=HSP70-10 PE=2 SV=1 8 367 3.0E-07
sp|Q3YZ26|HSCA_SHISS Chaperone protein HscA OS=Shigella sonnei (strain Ss046) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|Q32D38|HSCA_SHIDS Chaperone protein HscA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|B6I598|HSCA_ECOSE Chaperone protein HscA OS=Escherichia coli (strain SE11) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|P0A6Z1|HSCA_ECOLI Chaperone protein HscA OS=Escherichia coli (strain K12) GN=hscA PE=1 SV=1 4 339 4.0E-07
sp|B1IWD5|HSCA_ECOLC Chaperone protein HscA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|Q0TEV9|HSCA_ECOL5 Chaperone protein HscA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|A8A332|HSCA_ECOHS Chaperone protein HscA OS=Escherichia coli O9:H4 (strain HS) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|B1XB01|HSCA_ECODH Chaperone protein HscA OS=Escherichia coli (strain K12 / DH10B) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|C4ZXA1|HSCA_ECOBW Chaperone protein HscA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|B7M7M9|HSCA_ECO8A Chaperone protein HscA OS=Escherichia coli O8 (strain IAI1) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|B7MY19|HSCA_ECO81 Chaperone protein HscA OS=Escherichia coli O81 (strain ED1a) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|B5Z0Z9|HSCA_ECO5E Chaperone protein HscA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|P0A6Z2|HSCA_ECO57 Chaperone protein HscA OS=Escherichia coli O157:H7 GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|B7LDB8|HSCA_ECO55 Chaperone protein HscA OS=Escherichia coli (strain 55989 / EAEC) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|B7MIL6|HSCA_ECO45 Chaperone protein HscA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|Q835R7|DNAK_ENTFA Chaperone protein DnaK OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaK PE=3 SV=1 8 367 4.0E-07
sp|B1LNI1|HSCA_ECOSM Chaperone protein HscA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|B7UGX2|HSCA_ECO27 Chaperone protein HscA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=hscA PE=3 SV=1 4 339 4.0E-07
sp|B1H009|DNAK_UNCTG Chaperone protein DnaK OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=dnaK PE=3 SV=1 8 256 4.0E-07
sp|B8F7S6|DNAK_HAEPS Chaperone protein DnaK OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaK PE=3 SV=1 8 367 5.0E-07
sp|Q7VC04|DNAK1_PROMA Chaperone protein dnaK1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK1 PE=3 SV=1 8 366 5.0E-07
sp|B7N6B3|HSCA_ECOLU Chaperone protein HscA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hscA PE=3 SV=1 4 339 6.0E-07
sp|Q7VQL4|DNAK_BLOFL Chaperone protein DnaK OS=Blochmannia floridanus GN=dnaK PE=3 SV=1 8 477 6.0E-07
sp|A9AGU7|HSCA_BURM1 Chaperone protein HscA homolog OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hscA PE=3 SV=1 4 339 6.0E-07
sp|A9BWU9|HSCA_DELAS Chaperone protein HscA homolog OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=hscA PE=3 SV=1 4 339 6.0E-07
sp|B7LKB3|HSCA_ESCF3 Chaperone protein HscA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hscA PE=3 SV=1 4 339 6.0E-07
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 8 341 6.0E-07
sp|A7ZPW9|HSCA_ECO24 Chaperone protein HscA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hscA PE=3 SV=1 4 339 6.0E-07
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 9 247 7.0E-07
sp|Q1LPL1|HSCA_CUPMC Chaperone protein HscA homolog OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hscA PE=3 SV=1 4 341 7.0E-07
sp|Q30Q10|DNAK_SULDN Chaperone protein DnaK OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=dnaK PE=3 SV=1 92 367 7.0E-07
sp|Q3YRR6|DNAK_EHRCJ Chaperone protein DnaK OS=Ehrlichia canis (strain Jake) GN=dnaK PE=3 SV=1 129 367 8.0E-07
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 3 380 8.0E-07
sp|Q93R27|DNAK_TETHA Chaperone protein DnaK OS=Tetragenococcus halophilus GN=dnaK PE=3 SV=1 8 199 8.0E-07
sp|Q05866|GRP78_PLAFO 78 kDa glucose-regulated protein homolog OS=Plasmodium falciparum (isolate NF54) PE=3 SV=1 8 328 8.0E-07
sp|O05714|DNAK_ANAVT Chaperone protein DnaK OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaK PE=3 SV=1 8 366 9.0E-07
sp|Q5KWZ7|DNAK_GEOKA Chaperone protein DnaK OS=Geobacillus kaustophilus (strain HTA426) GN=dnaK PE=1 SV=1 8 328 9.0E-07
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 114 367 9.0E-07
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 8 341 1.0E-06
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 92 367 1.0E-06
sp|B0UR84|DNAK_METS4 Chaperone protein DnaK OS=Methylobacterium sp. (strain 4-46) GN=dnaK PE=3 SV=1 8 340 1.0E-06
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 8 340 1.0E-06
sp|Q5B0C0|HSP7M_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN6010 PE=1 SV=1 8 367 1.0E-06
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 9 254 1.0E-06
sp|B8CMW9|HSCA_SHEPW Chaperone protein HscA homolog OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=hscA PE=3 SV=1 129 328 1.0E-06
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 92 367 1.0E-06
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 97 328 1.0E-06
sp|Q3IFG5|HSCA_PSEHT Chaperone protein HscA homolog OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=hscA PE=3 SV=1 106 341 1.0E-06
sp|B7NRH5|HSCA_ECO7I Chaperone protein HscA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hscA PE=3 SV=1 4 339 1.0E-06
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 9 240 2.0E-06
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 106 328 2.0E-06
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 92 247 2.0E-06
sp|B8DT62|DNAK_BIFA0 Chaperone protein DnaK OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dnaK PE=3 SV=1 9 208 2.0E-06
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 114 366 2.0E-06
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 8 328 2.0E-06
sp|B8EIP9|DNAK_METSB Chaperone protein DnaK OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dnaK PE=3 SV=1 8 329 2.0E-06
sp|Q6FCE6|HSCA_ACIAD Chaperone protein HscA homolog OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hscA PE=3 SV=1 129 340 2.0E-06
sp|Q05647|DNAK_ERYRH Chaperone protein DnaK OS=Erysipelothrix rhusiopathiae GN=dnaK PE=3 SV=2 8 367 2.0E-06
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 9 366 2.0E-06
sp|Q5P1H5|DNAK_AROAE Chaperone protein DnaK OS=Aromatoleum aromaticum (strain EbN1) GN=dnaK PE=3 SV=1 8 497 2.0E-06
sp|A6TCE7|HSCA_KLEP7 Chaperone protein HscA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hscA PE=3 SV=1 4 339 2.0E-06
sp|A4G782|HSCA_HERAR Chaperone protein HscA homolog OS=Herminiimonas arsenicoxydans GN=hscA PE=3 SV=1 4 206 2.0E-06
sp|Q95YL7|HSP70_ENCHE Mitochondrial-type heat shock protein 70 OS=Encephalitozoon hellem GN=HSP70 PE=3 SV=1 8 367 2.0E-06
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 8 328 2.0E-06
sp|A1SPX5|DNAK_NOCSJ Chaperone protein DnaK OS=Nocardioides sp. (strain BAA-499 / JS614) GN=dnaK PE=3 SV=1 9 204 2.0E-06
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 1 366 3.0E-06
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 9 203 3.0E-06
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 92 367 3.0E-06
sp|Q31XW4|HSCA_SHIBS Chaperone protein HscA OS=Shigella boydii serotype 4 (strain Sb227) GN=hscA PE=3 SV=1 4 339 3.0E-06
sp|B2TXV1|HSCA_SHIB3 Chaperone protein HscA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hscA PE=3 SV=1 4 339 3.0E-06
sp|Q60C59|HSCA_METCA Chaperone protein HscA homolog OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hscA PE=3 SV=1 4 206 3.0E-06
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 129 367 4.0E-06
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 8 204 4.0E-06
sp|Q83QK4|HSCA_SHIFL Chaperone protein HscA homolog OS=Shigella flexneri GN=hscA PE=3 SV=2 4 339 4.0E-06
sp|Q0T1Z3|HSCA_SHIF8 Chaperone protein HscA OS=Shigella flexneri serotype 5b (strain 8401) GN=hscA PE=3 SV=1 4 339 4.0E-06
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 129 367 4.0E-06
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 129 367 4.0E-06
sp|B5XNK1|HSCA_KLEP3 Chaperone protein HscA OS=Klebsiella pneumoniae (strain 342) GN=hscA PE=3 SV=1 4 339 4.0E-06
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 129 367 4.0E-06
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 129 367 4.0E-06
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 92 367 4.0E-06
sp|Q08276|HSP7M_SOLTU Heat shock 70 kDa protein, mitochondrial OS=Solanum tuberosum GN=HSP68 PE=2 SV=1 8 367 4.0E-06
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 92 367 4.0E-06
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 92 367 5.0E-06
sp|Q3SIN4|DNAK_THIDA Chaperone protein DnaK OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaK PE=3 SV=1 8 528 5.0E-06
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 92 367 5.0E-06
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 92 367 5.0E-06
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 9 366 6.0E-06
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 92 367 6.0E-06
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 92 367 6.0E-06
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 1 366 7.0E-06
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 9 240 7.0E-06
sp|Q7NZ33|HSCA_CHRVO Chaperone protein HscA homolog OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hscA PE=3 SV=1 129 341 9.0E-06
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 114 366 9.0E-06
sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=3 8 367 9.0E-06
sp|A7ZVV7|DNAK_ECOHS Chaperone protein DnaK OS=Escherichia coli O9:H4 (strain HS) GN=dnaK PE=3 SV=1 8 496 9.0E-06
sp|Q3Z601|DNAK_SHISS Chaperone protein DnaK OS=Shigella sonnei (strain Ss046) GN=dnaK PE=3 SV=1 8 496 9.0E-06
sp|Q32KA5|DNAK_SHIDS Chaperone protein DnaK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaK PE=3 SV=1 8 496 9.0E-06
sp|Q326K7|DNAK_SHIBS Chaperone protein DnaK OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaK PE=3 SV=1 8 496 9.0E-06
sp|Q1RGI8|DNAK_ECOUT Chaperone protein DnaK OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaK PE=3 SV=1 8 496 9.0E-06
sp|P0A6Y8|DNAK_ECOLI Chaperone protein DnaK OS=Escherichia coli (strain K12) GN=dnaK PE=1 SV=2 8 496 9.0E-06
sp|B1IRG0|DNAK_ECOLC Chaperone protein DnaK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaK PE=3 SV=1 8 496 9.0E-06
sp|P0A6Y9|DNAK_ECOL6 Chaperone protein DnaK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaK PE=3 SV=2 8 496 9.0E-06
sp|Q0TLX5|DNAK_ECOL5 Chaperone protein DnaK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dnaK PE=3 SV=1 8 496 9.0E-06
sp|A1A766|DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC GN=dnaK PE=3 SV=1 8 496 9.0E-06
sp|P0A6Z0|DNAK_ECO57 Chaperone protein DnaK OS=Escherichia coli O157:H7 GN=dnaK PE=3 SV=2 8 496 9.0E-06
sp|A7ZHA4|DNAK_ECO24 Chaperone protein DnaK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaK PE=3 SV=1 8 496 9.0E-06
sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo abelii GN=HSPA9 PE=2 SV=1 8 367 1.0E-05
sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2 8 367 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0005524 ATP binding Yes
GO:0140657 ATP-dependent activity No
GO:0044183 protein folding chaperone No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0032555 purine ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2956
MMSERRIIVSIDFGTTYSGVAWAETTRPDVQHVISNWPSVSSFKSSPKVPTELRKVASGWQWGFQIPETAKRYRF
FKLKLDEPERANRDSESPQELTKVFLSCLHTHFISVLERRLSPGVVHSTPMDFVVTVPAIWSNAAKQATERAAAM
AGFCGSQRIQLISEPEAAALYTLKHLSPSVLQRGRRFVVCDAGGGTVDLISYEVTREDKLEIKEVTEGTGGKCGS
SMLNKRFRRYLKQTHGEKYWSDEKLVLALNEFELFKKDFAPKGEPLTLRVDESLGLRRNRFTMPQDDMTTRIFEP
LIKDVVCLVREQITMAGDEVAAVVLVGGFGQNAHLRSKVRDAVPAGIKIVQPENGWIAVVKGAAIHGLGQHQPTL
AEVEVASRVARRSYGTCLLAKYDLMRHDAKEAFWSEKEQESVVAEMCWFIKRGQSYPEDKPSTIEYQCDIPVGLG
HSPQTEIEIFSNDDDAEPPMHINSKTRCVATLSLDLDKIPKTVKLAAGKTRMGWHRYYCLHGVIEASYGSAMITY
TVKLGGVTHDAITVRYEED*
Coding >OphauG2|2956
ATGATGAGTGAAAGAAGAATCATTGTCTCAATAGACTTTGGCACGACATACTCGGGCGTCGCGTGGGCCGAGACG
ACTCGACCTGACGTCCAGCATGTCATTTCCAACTGGCCGTCCGTCAGCTCCTTCAAGAGCAGCCCCAAGGTGCCG
ACCGAGCTTCGCAAAGTAGCCTCGGGCTGGCAATGGGGCTTTCAGATTCCAGAGACGGCAAAGAGATATCGCTTC
TTTAAACTGAAGCTCGACGAGCCCGAGAGGGCAAACAGAGACTCTGAATCGCCCCAGGAGCTTACCAAGGTCTTC
TTGTCGTGTCTCCACACCCACTTCATCAGCGTGCTCGAGCGGCGGCTGTCGCCTGGCGTGGTGCATTCAACGCCC
ATGGACTTTGTCGTCACCGTTCCCGCCATATGGTCCAACGCAGCCAAGCAAGCCACCGAGCGAGCCGCTGCCATG
GCTGGCTTCTGTGGCAGCCAGCGAATCCAACTGATATCGGAGCCGGAAGCGGCTGCCTTGTATACTCTCAAGCAT
CTCAGCCCCTCGGTACTGCAGCGCGGTCGACGCTTCGTCGTGTGCGATGCCGGGGGCGGAACCGTAGACCTCATA
TCCTACGAGGTGACTCGCGAGGACAAGCTCGAGATCAAAGAGGTGACAGAGGGCACTGGCGGTAAGTGCGGCTCG
TCAATGCTCAACAAAAGATTTCGCCGATACTTGAAACAGACCCATGGTGAGAAATACTGGTCTGATGAGAAACTG
GTGCTGGCTCTCAATGAATTTGAACTGTTCAAAAAGGACTTTGCCCCCAAAGGAGAGCCGTTGACGCTGAGAGTC
GACGAGAGCCTGGGTCTGCGACGCAATCGATTCACCATGCCGCAAGACGACATGACTACGCGAATCTTTGAGCCT
TTGATCAAAGATGTTGTATGCCTTGTCCGAGAGCAAATCACCATGGCCGGAGACGAAGTGGCAGCAGTGGTTCTT
GTGGGCGGCTTTGGACAAAACGCCCACCTCAGAAGCAAAGTCCGAGACGCGGTGCCGGCCGGCATCAAGATTGTG
CAGCCTGAGAATGGCTGGATTGCAGTGGTCAAGGGAGCCGCAATCCACGGCTTGGGTCAGCACCAGCCGACGCTG
GCCGAGGTGGAAGTTGCATCCCGGGTCGCGAGGCGGTCATATGGCACTTGTCTGCTGGCAAAATACGATCTCATG
AGGCATGACGCCAAGGAGGCCTTCTGGTCTGAAAAGGAACAAGAATCCGTTGTAGCAGAGATGTGCTGGTTCATC
AAGAGGGGACAATCGTACCCAGAGGACAAGCCTTCCACCATCGAGTACCAATGCGATATTCCTGTTGGCCTGGGC
CATAGCCCGCAGACCGAGATTGAGATATTCAGCAACGACGACGACGCGGAGCCGCCCATGCATATCAACTCCAAG
ACACGCTGCGTGGCAACACTGTCGCTGGACCTAGACAAGATCCCCAAGACGGTCAAGCTGGCCGCGGGCAAGACG
AGAATGGGCTGGCATCGATACTACTGCCTGCACGGGGTCATCGAGGCTAGCTATGGCTCAGCCATGATTACATAT
ACCGTCAAGCTCGGAGGCGTGACTCACGATGCCATTACCGTGCGGTATGAAGAGGATTGA
Transcript >OphauG2|2956
ATGATGAGTGAAAGAAGAATCATTGTCTCAATAGACTTTGGCACGACATACTCGGGCGTCGCGTGGGCCGAGACG
ACTCGACCTGACGTCCAGCATGTCATTTCCAACTGGCCGTCCGTCAGCTCCTTCAAGAGCAGCCCCAAGGTGCCG
ACCGAGCTTCGCAAAGTAGCCTCGGGCTGGCAATGGGGCTTTCAGATTCCAGAGACGGCAAAGAGATATCGCTTC
TTTAAACTGAAGCTCGACGAGCCCGAGAGGGCAAACAGAGACTCTGAATCGCCCCAGGAGCTTACCAAGGTCTTC
TTGTCGTGTCTCCACACCCACTTCATCAGCGTGCTCGAGCGGCGGCTGTCGCCTGGCGTGGTGCATTCAACGCCC
ATGGACTTTGTCGTCACCGTTCCCGCCATATGGTCCAACGCAGCCAAGCAAGCCACCGAGCGAGCCGCTGCCATG
GCTGGCTTCTGTGGCAGCCAGCGAATCCAACTGATATCGGAGCCGGAAGCGGCTGCCTTGTATACTCTCAAGCAT
CTCAGCCCCTCGGTACTGCAGCGCGGTCGACGCTTCGTCGTGTGCGATGCCGGGGGCGGAACCGTAGACCTCATA
TCCTACGAGGTGACTCGCGAGGACAAGCTCGAGATCAAAGAGGTGACAGAGGGCACTGGCGGTAAGTGCGGCTCG
TCAATGCTCAACAAAAGATTTCGCCGATACTTGAAACAGACCCATGGTGAGAAATACTGGTCTGATGAGAAACTG
GTGCTGGCTCTCAATGAATTTGAACTGTTCAAAAAGGACTTTGCCCCCAAAGGAGAGCCGTTGACGCTGAGAGTC
GACGAGAGCCTGGGTCTGCGACGCAATCGATTCACCATGCCGCAAGACGACATGACTACGCGAATCTTTGAGCCT
TTGATCAAAGATGTTGTATGCCTTGTCCGAGAGCAAATCACCATGGCCGGAGACGAAGTGGCAGCAGTGGTTCTT
GTGGGCGGCTTTGGACAAAACGCCCACCTCAGAAGCAAAGTCCGAGACGCGGTGCCGGCCGGCATCAAGATTGTG
CAGCCTGAGAATGGCTGGATTGCAGTGGTCAAGGGAGCCGCAATCCACGGCTTGGGTCAGCACCAGCCGACGCTG
GCCGAGGTGGAAGTTGCATCCCGGGTCGCGAGGCGGTCATATGGCACTTGTCTGCTGGCAAAATACGATCTCATG
AGGCATGACGCCAAGGAGGCCTTCTGGTCTGAAAAGGAACAAGAATCCGTTGTAGCAGAGATGTGCTGGTTCATC
AAGAGGGGACAATCGTACCCAGAGGACAAGCCTTCCACCATCGAGTACCAATGCGATATTCCTGTTGGCCTGGGC
CATAGCCCGCAGACCGAGATTGAGATATTCAGCAACGACGACGACGCGGAGCCGCCCATGCATATCAACTCCAAG
ACACGCTGCGTGGCAACACTGTCGCTGGACCTAGACAAGATCCCCAAGACGGTCAAGCTGGCCGCGGGCAAGACG
AGAATGGGCTGGCATCGATACTACTGCCTGCACGGGGTCATCGAGGCTAGCTATGGCTCAGCCATGATTACATAT
ACCGTCAAGCTCGGAGGCGTGACTCACGATGCCATTACCGTGCGGTATGAAGAGGATTGA
Gene >OphauG2|2956
ATGATGAGTGAAAGAAGAATCATTGTCTCAATAGACTTTGGCACGACATACTCGGGCGTCGCGTGGGCCGAGACG
ACTCGAGTGAGCCTCTTGTTGCTGCGTCGTCGTGGCACCGCCCCTCGGTGGCTAACATGGAGCAGCCTGACGTCC
AGCATGTCATTTCCAACTGGCCGTCCGTCAGCTCCTTCAAGAGCAGCCCCAAGGTGCCGACCGAGCTTCGCAAAG
TAGCCTCGGGCTGGCAATGGGGCTTTCAGATTCCAGAGACGGCAAAGAGATATCGCTTCTTTAAACTGTTAGCCC
ATGGAAAGCCGTCAGACGCACATGAGAATAGCCCGTTGAGAATAATGTCGCAGGAAGCTCGACGAGCCCGAGAGG
GCAAACAGAGACTCTGAATCGCCCCAGGAGCTTACCAAGGTCTTCTTGTCGTGTCTCCACACCCACTTCATCAGC
GTGCTCGAGCGGCGGCTGTCGCCTGGCGTGGTGCATTCAACGCCCATGGACTTTGTCGTCACCGTTCCCGCCATA
TGGTCCAACGCAGCCAAGCAAGCCACCGAGCGAGCCGCTGCCATGGCTGGCTTCTGTGGCAGCCAGCGAATCCAA
CTGATATCGGAGCCGGTGCGCGTCTCTGTTTGACTTGCCTGCAGCCCAAGCCAGCCTTGATTAACGCCCCCTCAG
GAAGCGGCTGCCTTGTATACTCTCAAGCATCTCAGCCCCTCGGTACTGCAGCGCGGTCGACGCTTCGTCGTGTGC
GATGCCGGGGGCGGAACCGTAGACCTCATATCCTACGAGGTGACTCGCGAGGACAAGCTCGAGATCAAAGAGGTG
ACAGAGGGCACTGGCGGTAAGTGCGGCTCGTCAATGCTCAACAAAAGATTTCGCCGATACTTGAAACAGACCCAT
GGTGAGAAATACTGGTCTGATGAGAAACTGGTGCTGGCTCTCAATGAATTTGAACTGGCAAGTCTTGCCGCGTGC
AGAGACACATGTTGGCTTCGTGACCGCCATGGCTAAGCCCCAGAGTAATGCAGTTCAAAAAGGACTTTGCCCCCA
AAGGAGAGCCGTTGACGCTGAGAGTCGACGAGAGCCTGGGTCTGCGACGCAATCGATTCACCATGCCGCAAGACG
ACATGACTACGCGAATCTTTGAGCCTTTGATCAAAGATGTTGTATGCCTTGTCCGAGAGCAAATCACCATGGCCG
GAGACGAAGTGGCAGCAGTGGTTCTTGTGGGCGGCTTTGGACAAAACGCCCACCTCAGAAGCAAAGTCCGAGACG
CGGTGCCGGCCGGCATCAAGATTGTGCAGCCTGAGAATGGCTGGATTGCAGTGGTCAAGGGAGCCGCAATCCACG
GCTTGGGTCAGCACCAGCCGACGCTGGCCGAGGTGGAAGTTGCATCCCGGGTCGCGAGGCGGTCATATGGCACTT
GTCTGCTGGCAAAATACGATCTCATGAGGCATGACGCCAAGGAGGCGTGAGTGAGGACAGCTGAGTGCTTGGTGG
GCAGCGGCTGACCCTGTCGTCTGCAGCTTCTGGTCTGAAAAGGAACAAGAATCCGTTGTAGCAGAGATGTGCTGG
TTCATCAAGAGGGTCAGGATTGCGAGTCCAGGTCCGGGCAGGCCAACTTGACTGACATGACCCCCAGGGACAATC
GTACCCAGAGGACAAGCCTTCCACCATCGAGTACCAATGCGATATTCCTGTTGGCCTGGGCCATAGCCCGCAGAC
CGAGATTGAGATATTCAGCAACGACGACGACGCGGAGCCGCCCATGCATATCAACTCCAAGACACGCTGCGTGGC
AACACTGTCGCTGGACCTAGACAAGATCCCCAAGACGGTCAAGCTGGCCGCGGGCAAGACGAGAATGGGCTGGCA
TCGATACTACTGCCTGCACGGGGTCATCGAGGCTAGCTATGGCTCAGCCATGATTACATATACCGTCAAGCTCGG
AGGTATGGCTTTTGCTGCTTTTGCTGCGTTTGCGTCTTTTGAGCACGGCCAAGGCACTGACCAGACAGGCGTGAC
TCACGATGCCATTACCGTGCGGTATGAAGAGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail