Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2943
Gene name
LocationContig_2151:185..1037
Strand-
Gene length (bp)852
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup84
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1577
Ophiocordyceps australis 1348a (Ghana) OphauG2|2943 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|5919
Ophiocordyceps australis map64 (Brazil) OphauB2|1448
Ophiocordyceps australis map64 (Brazil) OphauB2|1752
Ophiocordyceps australis map64 (Brazil) OphauB2|1755
Ophiocordyceps australis map64 (Brazil) OphauB2|2666
Ophiocordyceps australis map64 (Brazil) OphauB2|4190
Ophiocordyceps australis map64 (Brazil) OphauB2|4691
Ophiocordyceps australis map64 (Brazil) OphauB2|4872
Ophiocordyceps australis map64 (Brazil) OphauB2|5124
Ophiocordyceps australis map64 (Brazil) OphauB2|7730
Ophiocordyceps kimflemingae Ophio5|7512
Ophiocordyceps subramaniannii Hirsu2|1991
Ophiocordyceps subramaniannii Hirsu2|4897
Ophiocordyceps subramaniannii Hirsu2|7175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2943
MWPLKLLADVFASAFDYDENMDVDHLRKQREQGWTQRYKELIGYLSSEEYRNKLKERYALEISSHLYVLSEASAM
LYVGEVVADEATDSPQDAQQAEAKVEDSWIETQQEVCAAVLDTERRFDNDVPEQTAKWIEDEYYAYYTRWRRGFF
TNRERAWAKEKAYMRGRPLFSAPTEATIKQRENDFWDKVYNVDDELRKEKRNNFNKQDVVNFAKDAVKQIPRDHG
LCNGPPLKMGAPPPREAPAYEDLIDKIMAEEIPHIRLFRDEYFRGEMDEMLAPLGECG*
Coding >OphauG2|2943
ATGTGGCCGTTGAAGCTCCTCGCCGACGTCTTCGCCAGCGCCTTTGACTACGATGAAAACATGGACGTCGACCAC
CTCCGGAAACAACGCGAGCAAGGCTGGACGCAGCGATACAAGGAGCTCATTGGCTACCTCTCCTCTGAAGAATAC
CGCAACAAACTCAAGGAGCGCTACGCCCTGGAAATCTCCTCCCATCTCTACGTCTTGTCCGAAGCCAGCGCCATG
CTCTACGTTGGCGAAGTGGTGGCCGACGAAGCCACCGACTCGCCGCAAGACGCCCAGCAAGCAGAAGCCAAAGTC
GAAGACTCGTGGATCGAAACCCAGCAAGAAGTCTGCGCGGCCGTCCTGGACACTGAGCGCCGCTTCGACAACGAC
GTGCCCGAGCAAACGGCCAAATGGATCGAAGACGAATACTACGCATACTACACCCGCTGGCGCAGAGGCTTCTTC
ACAAACAGAGAACGGGCCTGGGCTAAAGAAAAAGCGTATATGCGTGGCCGGCCGTTGTTTTCCGCCCCTACAGAA
GCCACGATTAAGCAACGCGAAAATGATTTCTGGGACAAGGTGTACAACGTCGATGACGAGCTGCGCAAGGAGAAG
CGCAACAATTTCAACAAGCAAGACGTGGTGAATTTTGCAAAGGATGCCGTCAAGCAGATTCCGCGCGACCATGGA
CTCTGCAACGGCCCGCCTCTCAAAATGGGCGCCCCGCCGCCGCGAGAGGCGCCGGCTTATGAAGACCTCATTGAC
AAGATTATGGCCGAGGAGATTCCTCACATCCGCCTGTTTCGAGATGAGTATTTCCGCGGCGAGATGGACGAGATG
CTGGCTCCTCTGGGCGAATGCGGTTAG
Transcript >OphauG2|2943
ATGTGGCCGTTGAAGCTCCTCGCCGACGTCTTCGCCAGCGCCTTTGACTACGATGAAAACATGGACGTCGACCAC
CTCCGGAAACAACGCGAGCAAGGCTGGACGCAGCGATACAAGGAGCTCATTGGCTACCTCTCCTCTGAAGAATAC
CGCAACAAACTCAAGGAGCGCTACGCCCTGGAAATCTCCTCCCATCTCTACGTCTTGTCCGAAGCCAGCGCCATG
CTCTACGTTGGCGAAGTGGTGGCCGACGAAGCCACCGACTCGCCGCAAGACGCCCAGCAAGCAGAAGCCAAAGTC
GAAGACTCGTGGATCGAAACCCAGCAAGAAGTCTGCGCGGCCGTCCTGGACACTGAGCGCCGCTTCGACAACGAC
GTGCCCGAGCAAACGGCCAAATGGATCGAAGACGAATACTACGCATACTACACCCGCTGGCGCAGAGGCTTCTTC
ACAAACAGAGAACGGGCCTGGGCTAAAGAAAAAGCGTATATGCGTGGCCGGCCGTTGTTTTCCGCCCCTACAGAA
GCCACGATTAAGCAACGCGAAAATGATTTCTGGGACAAGGTGTACAACGTCGATGACGAGCTGCGCAAGGAGAAG
CGCAACAATTTCAACAAGCAAGACGTGGTGAATTTTGCAAAGGATGCCGTCAAGCAGATTCCGCGCGACCATGGA
CTCTGCAACGGCCCGCCTCTCAAAATGGGCGCCCCGCCGCCGCGAGAGGCGCCGGCTTATGAAGACCTCATTGAC
AAGATTATGGCCGAGGAGATTCCTCACATCCGCCTGTTTCGAGATGAGTATTTCCGCGGCGAGATGGACGAGATG
CTGGCTCCTCTGGGCGAATGCGGTTAG
Gene >OphauG2|2943
ATGTGGCCGTTGAAGCTCCTCGCCGACGTCTTCGCCAGCGCCTTTGACTACGATGAAAACATGGACGTCGACCAC
CTCCGGAAACAACGCGAGCAAGGCTGGACGCAGCGATACAAGGAGCTCATTGGCTACCTCTCCTCTGAAGAATAC
CGCAACAAACTCAAGGAGCGCTACGCCCTGGAAATCTCCTCCCATCTCTACGTCTTGTCCGAAGCCAGCGCCATG
CTCTACGTTGGCGAAGTGGTGGCCGACGAAGCCACCGACTCGCCGCAAGACGCCCAGCAAGCAGAAGCCAAAGTC
GAAGACTCGTGGATCGAAACCCAGCAAGAAGTCTGCGCGGCCGTCCTGGACACTGAGCGCCGCTTCGACAACGAC
GTGCCCGAGCAAACGGCCAAATGGATCGAAGACGAATACTACGCATACTACACCCGCTGGCGCAGAGGCTTCTTC
ACAAACAGAGAACGGGCCTGGGCTAAAGAAAAAGCGTATATGCGTGGCCGGCCGTTGTTTTCCGCCCCTACAGAA
GCCACGATTAAGCAACGCGAAAATGATTTCTGGGACAAGGTGTACAACGTCGATGACGAGCTGCGCAAGGAGAAG
CGCAACAATTTCAACAAGCAAGACGTGGTGAATTTTGCAAAGGATGCCGTCAAGCAGATTCCGCGCGACCATGGA
CTCTGCAACGGCCCGCCTCTCAAAATGGGCGCCCCGCCGCCGCGAGAGGCGCCGGCTTATGAAGACCTCATTGAC
AAGATTATGGCCGAGGAGATTCCTCACATCCGCCTGTTTCGAGATGAGTATTTCCGCGGCGAGATGGACGAGATG
CTGGCTCCTCTGGGCGAATGCGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail