Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2937
Gene name
LocationContig_215:15102..17104
Strand+
Gene length (bp)2002
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04922 DIE2_ALG10 DIE2/ALG10 family 7.2E-106 57 500

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZE0|ALG10_GIBZE Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG10 PE=3 SV=1 28 548 3.0E-149
sp|Q7SA35|ALG10_NEUCR Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-10 PE=3 SV=3 35 487 1.0E-125
sp|P0C147|ALG10_MAGO7 Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ALG10 PE=3 SV=1 35 553 1.0E-116
sp|Q5B0M8|ALG10_EMENI Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alg10 PE=3 SV=1 46 534 2.0E-64
sp|Q4X162|ALG10_ASPFU Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg10 PE=3 SV=1 46 466 2.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZE0|ALG10_GIBZE Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG10 PE=3 SV=1 28 548 3.0E-149
sp|Q7SA35|ALG10_NEUCR Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-10 PE=3 SV=3 35 487 1.0E-125
sp|P0C147|ALG10_MAGO7 Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ALG10 PE=3 SV=1 35 553 1.0E-116
sp|Q5B0M8|ALG10_EMENI Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alg10 PE=3 SV=1 46 534 2.0E-64
sp|Q4X162|ALG10_ASPFU Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg10 PE=3 SV=1 46 466 2.0E-64
sp|Q6CEA5|ALG10_YARLI Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG10 PE=3 SV=1 42 462 5.0E-33
sp|Q6BW42|ALG10_DEBHA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG10 PE=3 SV=1 31 461 6.0E-32
sp|Q75AQ8|ALG10_ASHGO Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG10 PE=3 SV=2 38 471 2.0E-30
sp|P50076|ALG10_YEAST Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIE2 PE=1 SV=2 48 471 6.0E-28
sp|Q6FL34|ALG10_CANGA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG10 PE=3 SV=1 33 478 9.0E-27
sp|Q10254|ALG10_SCHPO Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg10 PE=3 SV=1 30 459 1.0E-25
sp|Q59YV2|ALG10_CANAL Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG10 PE=3 SV=1 48 483 5.0E-25
sp|Q6CN27|ALG10_KLULA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG10 PE=3 SV=1 45 471 4.0E-24
sp|Q5BKT4|AG10A_HUMAN Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Homo sapiens GN=ALG10 PE=2 SV=1 44 474 4.0E-24
sp|Q3UGP8|AG10B_MOUSE Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Mus musculus GN=Alg10b PE=2 SV=1 44 472 3.0E-22
sp|Q8T8L8|ALG10_DROME Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Drosophila melanogaster GN=Alg10 PE=2 SV=1 29 348 3.0E-21
sp|O88788|AG10B_RAT Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Rattus norvegicus GN=Alg10b PE=1 SV=1 44 472 7.0E-21
sp|Q5I7T1|AG10B_HUMAN Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Homo sapiens GN=ALG10B PE=1 SV=2 44 345 7.0E-20
sp|Q4P2W6|ALG10_USTMA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ALG10 PE=3 SV=1 140 455 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0106073 dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity Yes
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009987 cellular process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006629 lipid metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016758 hexosyltransferase activity No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 4 22 18
2 29 51 22
3 84 106 22
4 119 141 22
5 156 178 22
6 309 331 22
7 346 368 22
8 462 484 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2937
MLGIHVAYCAPLLAFAIHMASTRKSPLPHGSLPLLLLAIFGASSFLWYRGVSTTLSDAYLDEVFHIPQAQKYCKG
RFREWDDKLTTPPGLYILSMVPVMTLKLLGFRDWISACSASGLRAFNALGLLVVGYLAMLCRWQIEEAANPGPAP
LPISEYAFHTAVNILLFPILFFFSGLYYTDVVSTAVVAGALLNHLGRVARPRTSWANDWLTVALGTLALLMRQTN
IFFVLVYMGGLEAIHAVKRPRLQRAHEPRDMTLWQRLKFLGGQYSLGHVHDPPLSQAWPDDVLLTATSLAIAVVC
NPVRVARHIWPHLAVLVIFGGFVAWNGGVVLGDKTNHVATTHLAQMLYIWPLFVFFSLPLFLPVLLPVTRAFKTF
ASHKNKALDGVGNEQGNRHESILPRQSETIPQVPTSVKMCIWATHLVGTAVLSALVVRYNTIIHPFTLADNRHYM
FYIFRYTIRRSLLIRYLLILPYTLCRFLVWSALAGCSDWSQQGPWQTCSSQTPIPPTSAPLARSTKSLSSRQQDA
YESDASSSSLTYSAAPVQTSTALSLATSSCRGYCGVYLSQHGVQTTVQLGLGM*
Coding >OphauG2|2937
ATGCTTGGAATCCACGTGGCGTACTGCGCGCCTCTCCTGGCCTTTGCTATTCACATGGCCTCGACACGCAAATCG
CCTCTGCCGCATGGATCATTGCCGCTTCTGTTGCTCGCAATTTTTGGAGCATCGTCCTTTTTGTGGTACCGAGGC
GTTTCCACGACGCTTTCTGATGCATACCTGGACGAAGTTTTTCATATACCCCAAGCTCAGAAATACTGCAAGGGT
CGGTTTCGCGAATGGGACGACAAGCTCACCACGCCACCTGGTCTGTACATCTTGTCCATGGTACCCGTCATGACA
CTCAAGCTGCTTGGCTTCAGAGATTGGATATCCGCGTGCAGTGCGAGTGGTCTTCGGGCTTTTAATGCCCTTGGG
CTGCTCGTCGTGGGATACCTGGCGATGCTTTGCCGTTGGCAAATTGAAGAAGCAGCCAATCCAGGTCCAGCACCA
TTGCCGATATCAGAGTATGCCTTTCACACAGCCGTCAATATTCTTCTCTTTCCCATCCTCTTCTTCTTCTCGGGC
CTCTATTACACTGATGTCGTTTCAACCGCCGTCGTTGCCGGTGCTTTGCTCAACCATCTCGGCCGCGTGGCTCGC
CCTCGTACTAGTTGGGCAAACGACTGGTTGACAGTCGCCTTGGGTACTCTGGCGCTTTTGATGCGCCAGACAAAC
ATTTTCTTCGTCCTTGTCTACATGGGCGGCCTCGAGGCAATCCACGCAGTCAAGAGGCCAAGGCTACAGAGAGCA
CATGAGCCTCGTGACATGACGTTGTGGCAACGGCTCAAGTTTCTCGGCGGGCAGTACTCCCTTGGTCATGTTCAT
GACCCGCCTCTTAGCCAAGCCTGGCCAGATGATGTGCTTTTGACTGCCACGAGTCTGGCAATTGCCGTCGTTTGT
AACCCTGTGCGAGTCGCGAGGCACATTTGGCCCCATCTCGCCGTCCTCGTGATATTTGGCGGCTTTGTGGCCTGG
AATGGGGGCGTGGTTCTTGGCGACAAGACGAATCACGTTGCCACCACCCACCTGGCTCAGATGCTTTATATATGG
CCACTATTTGTCTTCTTTTCACTACCCCTTTTTTTGCCCGTGCTTCTCCCCGTCACACGAGCATTCAAAACATTT
GCTAGCCACAAAAACAAGGCGCTGGATGGTGTAGGAAACGAGCAAGGCAACCGACATGAATCAATCTTGCCCAGA
CAGTCCGAGACTATCCCGCAGGTGCCCACTTCAGTCAAAATGTGCATATGGGCCACGCATCTTGTTGGCACAGCT
GTTCTCTCAGCCTTGGTGGTGCGATACAACACCATTATTCATCCCTTTACCCTCGCCGACAACCGACACTACATG
TTTTATATTTTCCGATATACTATTCGCCGCAGCCTCTTGATTAGATACCTGCTCATCCTGCCATACACCCTCTGC
CGATTTCTCGTCTGGAGCGCACTAGCAGGCTGCAGCGACTGGAGCCAACAAGGCCCATGGCAGACATGCTCGTCG
CAAACCCCAATTCCTCCTACATCAGCTCCCTTGGCACGCAGCACCAAGTCACTCTCAAGTCGACAACAAGATGCC
TACGAGTCAGATGCATCGAGCAGCTCTCTCACCTACTCTGCCGCCCCAGTCCAAACATCGACGGCTCTCAGCCTC
GCTACTTCATCGTGCCGTGGCTACTGTGGCGTCTACTTGTCCCAGCATGGCGTGCAGACTACTGTACAGCTCGGC
TTGGGCATGTAG
Transcript >OphauG2|2937
ATGCTTGGAATCCACGTGGCGTACTGCGCGCCTCTCCTGGCCTTTGCTATTCACATGGCCTCGACACGCAAATCG
CCTCTGCCGCATGGATCATTGCCGCTTCTGTTGCTCGCAATTTTTGGAGCATCGTCCTTTTTGTGGTACCGAGGC
GTTTCCACGACGCTTTCTGATGCATACCTGGACGAAGTTTTTCATATACCCCAAGCTCAGAAATACTGCAAGGGT
CGGTTTCGCGAATGGGACGACAAGCTCACCACGCCACCTGGTCTGTACATCTTGTCCATGGTACCCGTCATGACA
CTCAAGCTGCTTGGCTTCAGAGATTGGATATCCGCGTGCAGTGCGAGTGGTCTTCGGGCTTTTAATGCCCTTGGG
CTGCTCGTCGTGGGATACCTGGCGATGCTTTGCCGTTGGCAAATTGAAGAAGCAGCCAATCCAGGTCCAGCACCA
TTGCCGATATCAGAGTATGCCTTTCACACAGCCGTCAATATTCTTCTCTTTCCCATCCTCTTCTTCTTCTCGGGC
CTCTATTACACTGATGTCGTTTCAACCGCCGTCGTTGCCGGTGCTTTGCTCAACCATCTCGGCCGCGTGGCTCGC
CCTCGTACTAGTTGGGCAAACGACTGGTTGACAGTCGCCTTGGGTACTCTGGCGCTTTTGATGCGCCAGACAAAC
ATTTTCTTCGTCCTTGTCTACATGGGCGGCCTCGAGGCAATCCACGCAGTCAAGAGGCCAAGGCTACAGAGAGCA
CATGAGCCTCGTGACATGACGTTGTGGCAACGGCTCAAGTTTCTCGGCGGGCAGTACTCCCTTGGTCATGTTCAT
GACCCGCCTCTTAGCCAAGCCTGGCCAGATGATGTGCTTTTGACTGCCACGAGTCTGGCAATTGCCGTCGTTTGT
AACCCTGTGCGAGTCGCGAGGCACATTTGGCCCCATCTCGCCGTCCTCGTGATATTTGGCGGCTTTGTGGCCTGG
AATGGGGGCGTGGTTCTTGGCGACAAGACGAATCACGTTGCCACCACCCACCTGGCTCAGATGCTTTATATATGG
CCACTATTTGTCTTCTTTTCACTACCCCTTTTTTTGCCCGTGCTTCTCCCCGTCACACGAGCATTCAAAACATTT
GCTAGCCACAAAAACAAGGCGCTGGATGGTGTAGGAAACGAGCAAGGCAACCGACATGAATCAATCTTGCCCAGA
CAGTCCGAGACTATCCCGCAGGTGCCCACTTCAGTCAAAATGTGCATATGGGCCACGCATCTTGTTGGCACAGCT
GTTCTCTCAGCCTTGGTGGTGCGATACAACACCATTATTCATCCCTTTACCCTCGCCGACAACCGACACTACATG
TTTTATATTTTCCGATATACTATTCGCCGCAGCCTCTTGATTAGATACCTGCTCATCCTGCCATACACCCTCTGC
CGATTTCTCGTCTGGAGCGCACTAGCAGGCTGCAGCGACTGGAGCCAACAAGGCCCATGGCAGACATGCTCGTCG
CAAACCCCAATTCCTCCTACATCAGCTCCCTTGGCACGCAGCACCAAGTCACTCTCAAGTCGACAACAAGATGCC
TACGAGTCAGATGCATCGAGCAGCTCTCTCACCTACTCTGCCGCCCCAGTCCAAACATCGACGGCTCTCAGCCTC
GCTACTTCATCGTGCCGTGGCTACTGTGGCGTCTACTTGTCCCAGCATGGCGTGCAGACTACTGTACAGCTCGGC
TTGGGCATGTAG
Gene >OphauG2|2937
ATGCTTGGAATCCACGTGGCGTACTGCGCGCCTCTCCTGGCCTTTGCTATTCACATGGCCTCGACACGCAAATCG
CCTCTGCCGCATGGATCATTGCCGCTTCTGTTGCTCGCAATTTTTGGAGCATCGTCCTTTTTGTGGTACCGAGGC
GTTTCCACGACGCTTTCTGATGCATACCTGGTGAGTTGGCCTCGTCGCTTCAACGCGAATGCTCCAAAGCTTACG
TGCAAGCAGGACGAAGTTTTTCATATACCCCAAGCTCAGAAATACTGCAAGGGTCGGTTTCGCGAATGGGACGAC
AAGCTCACCACGCCACCTGGTCTGTGAGTGGTGACAAGTGAGAAAAACAAGAGCTATACAGTGCGCTAACCTCGG
CCAAGGTACATCTTGTCCATGGTACCCGTCATGACACTCAAGCTGCTTGGCTTCAGAGATTGGATATCCGCGTGC
AGTGCGAGTGGTCTTCGGGCTTTTAATGCCCTTGGGCTGCTCGTCGTGGGATACCTGGCGATGCTTTGCCGTTGG
CAAATTGAAGAAGCAGCCAATCCAGGTCCAGCACCATTGCCGATATCAGAGTATGCCTTTCACACAGCCGTCAAT
ATTCTTCTCTTTCCCATCCTCTTCTTCTTCTCGGGCCTCTATTACACTGATGTCGTTTCAACCGCCGTCGTTGCC
GGTGCTTTGCTCAACCATCTCGGCCGCGTGGCTCGCCCTCGTACTAGTTGGGCAAACGACTGGTTGACAGTCGCC
TTGGGTACTCTGGCGCTTTTGATGCGCCAGACAAACATTTTCTTCGTCCTTGTCTACATGGGCGGCCTCGAGGCA
ATCCACGCAGTCAAGAGGCCAAGGCTACAGAGAGCACATGAGCCTCGTGACATGACGTTGTGGCAACGGCTCAAG
TTTCTCGGCGGGCAGTACTCCCTTGGTCATGTTCATGACCCGCCTCTTAGCCAAGCCTGGCCAGATGGTGAGTCG
CAGCGCCAGTGCTATCTTGGATTGGTGGAAACTAATTGGCCTTTGGCAGATGTGCTTTTGACTGCCACGAGTCTG
GCAATTGCCGTCGTTTGTAACCCTGTGCGAGTCGCGAGGCACATTTGGCCCCATCTCGCCGTCCTCGTGATATTT
GGCGGCTTTGTGGCCTGGAATGGGGGCGTGGTTCTTGGTGAGTCCTGAGGTGCGAAGCGAGGCGTCTTGTATTGA
CTCAGTGCAGGCGACAAGACGAATCACGTTGCCACCACCCACCTGGCTCAGATGCTTTATATATGGCCACTATTT
GTCTTCTTTTCACTACCCCTTTTTTTGCCCGTGCTTCTCCCCGTCACACGAGCATTCAAAACATTTGCTAGCCAC
AAAAACAAGGCGCTGGATGGTGTAGGAAACGAGCAAGGCAACCGACATGAATCAATCTTGCCCAGACAGTCCGAG
ACTATCCCGCAGGTGCCCACTTCAGTCAAAATGTGCATATGGGCCACGCATCTTGTTGGCACAGCTGTTCTCTCA
GCCTTGGTGGTGCGATACAACACCATTATTCATCCCTTTACCCTCGCCGACAACCGACACTACATGTTTTATATT
TTCCGATATACTATTCGCCGCAGCCTCTTGATTAGATACCTGCTCATCCTGCCATACACCCTCTGCCGATTTCTC
GTCTGGAGCGCACTAGCAGGCTGCAGCGACTGGAGCCAACAAGGCCCATGGCAGACATGCTCGTCGCAAACCCCA
ATTCCTCCTACATCAGCTCCCTTGGCACGCAGCACCAAGTCACTCTCAAGTCGACAACAAGATGCCTACGAGTCA
GATGCATCGAGCAGCTCTCTCACCTACTCTGCCGCCCCAGTCCAAACATCGACGGCTCTCGTATTCCTCGCTGCT
ACTAGTCTCTCGCTCGTGACAGCGCCGCTGGTAGAGCCTCGCTACTTCATCGTGCCGTGGCTACTGTGGCGTCTA
CTTGTCCCAGCATGGCGTGCAGACTACTGTACAGCTCGGCTTGGGCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail