Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2933
Gene name
LocationContig_215:5119..6214
Strand-
Gene length (bp)1095
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04000 Sas10_Utp3 Sas10/Utp3/C1D family 9.9E-17 14 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09713|YA36_SCHPO Uncharacterized protein C18B11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18B11.06 PE=1 SV=1 11 351 2.0E-28
sp|P40079|LCP5_YEAST U3 small nucleolar ribonucleoprotein protein LCP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCP5 PE=1 SV=1 7 296 7.0E-17
sp|Q2KII6|NGDN_BOVIN Neuroguidin OS=Bos taurus GN=NGDN PE=2 SV=1 1 116 3.0E-11
sp|Q8NEJ9|NGDN_HUMAN Neuroguidin OS=Homo sapiens GN=NGDN PE=1 SV=1 4 116 5.0E-10
sp|Q9DB96|NGDN_MOUSE Neuroguidin OS=Mus musculus GN=Ngdn PE=1 SV=1 35 116 4.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09713|YA36_SCHPO Uncharacterized protein C18B11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18B11.06 PE=1 SV=1 11 351 2.0E-28
sp|P40079|LCP5_YEAST U3 small nucleolar ribonucleoprotein protein LCP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCP5 PE=1 SV=1 7 296 7.0E-17
sp|Q2KII6|NGDN_BOVIN Neuroguidin OS=Bos taurus GN=NGDN PE=2 SV=1 1 116 3.0E-11
sp|Q8NEJ9|NGDN_HUMAN Neuroguidin OS=Homo sapiens GN=NGDN PE=1 SV=1 4 116 5.0E-10
sp|Q9DB96|NGDN_MOUSE Neuroguidin OS=Mus musculus GN=Ngdn PE=1 SV=1 35 116 4.0E-09
sp|Q28IV8|NGDN_XENTR Neuroguidin OS=Xenopus tropicalis GN=ngdn PE=2 SV=1 37 280 9.0E-09
sp|Q4KLC4|NGDNA_XENLA Neuroguidin-A OS=Xenopus laevis GN=ngdn-a PE=1 SV=1 37 116 5.0E-08
sp|Q6PFJ1|NGDN_DANRE Neuroguidin OS=Danio rerio GN=ngdn PE=2 SV=1 4 143 5.0E-08
sp|Q5M985|NGDNB_XENLA Neuroguidin-B (Fragment) OS=Xenopus laevis GN=ngdn-b PE=1 SV=1 37 116 6.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2933
MAAPTTLSALLTWLNQSLSLAQEATPKLEEYKHPQNGISLLDVKNDLLLSYLQNLVFLILLKLRNAKSDGNSTDA
HQEIPQGVRLKLVELRVYLEKGVRPLEEKLKFSIDRFLRTAQDAQREQQKKSTKLKAEARSDDSDDSGSDRHRDG
SASESNDAVIAAPRPGSLIDVVSIKPAEDQDAPPGIYRPPRRERKVMETTRPRGKAVSQPRRSHTMDEFISAELS
TVPLAEPSIGTTIVQGGRRTKTSQERKIEQERREYEETNLVRLPKASKKERAKMKQQAGRSRRMQFGGEDWHELG
EGVDRIDRLTKRKGPAEGNVRALLEKSRKRGMDTTDGPRGSGQGVEIGERFRKKVKTMKRSKMW*
Coding >OphauG2|2933
ATGGCAGCGCCCACCACCTTGTCGGCTCTTCTGACTTGGTTGAACCAGTCATTGTCGCTTGCTCAGGAGGCGACG
CCAAAACTAGAGGAATACAAGCACCCCCAAAATGGCATCTCGCTGCTCGACGTCAAGAACGACTTGCTGCTCTCC
TACTTGCAAAATCTCGTTTTCCTTATCCTTCTCAAGCTGCGAAATGCAAAGTCTGATGGCAACTCAACCGACGCC
CATCAAGAGATTCCCCAAGGTGTTCGCCTGAAGCTAGTCGAACTACGAGTCTATCTGGAAAAGGGTGTTCGGCCG
TTGGAAGAAAAGCTCAAGTTCTCCATTGACCGCTTTCTCCGAACAGCTCAAGATGCACAACGCGAGCAGCAGAAA
AAGAGCACAAAATTGAAAGCCGAGGCCAGGTCTGACGACTCTGACGACTCTGGGTCGGATCGGCATCGTGATGGA
TCTGCATCTGAAAGCAATGATGCAGTAATTGCCGCACCTAGGCCTGGAAGCTTGATAGACGTCGTCTCCATCAAG
CCGGCAGAAGACCAAGACGCGCCGCCTGGTATTTACCGCCCGCCGCGACGAGAACGCAAAGTTATGGAGACGACG
CGGCCGCGCGGAAAAGCCGTTTCCCAACCTCGCCGCTCCCATACCATGGACGAATTTATCAGCGCAGAGCTCTCT
ACCGTGCCGCTAGCGGAGCCCAGCATCGGCACAACCATTGTCCAGGGCGGGCGCAGGACGAAGACGTCGCAGGAG
CGCAAGATTGAACAAGAACGCCGCGAGTACGAAGAAACAAACCTGGTGCGCTTGCCCAAGGCCAGCAAGAAGGAG
CGCGCCAAGATGAAGCAGCAGGCGGGGCGCAGCCGGCGCATGCAGTTTGGCGGCGAGGACTGGCACGAGTTGGGC
GAGGGCGTCGACCGCATCGACCGCCTTACCAAGCGCAAAGGTCCGGCCGAAGGCAATGTGCGCGCCCTGCTGGAA
AAGAGCCGCAAACGTGGCATGGACACGACGGATGGGCCCCGAGGCAGCGGCCAGGGAGTCGAGATTGGAGAGAGA
TTTCGCAAAAAAGTCAAGACTATGAAGAGGAGCAAAATGTGGTAG
Transcript >OphauG2|2933
ATGGCAGCGCCCACCACCTTGTCGGCTCTTCTGACTTGGTTGAACCAGTCATTGTCGCTTGCTCAGGAGGCGACG
CCAAAACTAGAGGAATACAAGCACCCCCAAAATGGCATCTCGCTGCTCGACGTCAAGAACGACTTGCTGCTCTCC
TACTTGCAAAATCTCGTTTTCCTTATCCTTCTCAAGCTGCGAAATGCAAAGTCTGATGGCAACTCAACCGACGCC
CATCAAGAGATTCCCCAAGGTGTTCGCCTGAAGCTAGTCGAACTACGAGTCTATCTGGAAAAGGGTGTTCGGCCG
TTGGAAGAAAAGCTCAAGTTCTCCATTGACCGCTTTCTCCGAACAGCTCAAGATGCACAACGCGAGCAGCAGAAA
AAGAGCACAAAATTGAAAGCCGAGGCCAGGTCTGACGACTCTGACGACTCTGGGTCGGATCGGCATCGTGATGGA
TCTGCATCTGAAAGCAATGATGCAGTAATTGCCGCACCTAGGCCTGGAAGCTTGATAGACGTCGTCTCCATCAAG
CCGGCAGAAGACCAAGACGCGCCGCCTGGTATTTACCGCCCGCCGCGACGAGAACGCAAAGTTATGGAGACGACG
CGGCCGCGCGGAAAAGCCGTTTCCCAACCTCGCCGCTCCCATACCATGGACGAATTTATCAGCGCAGAGCTCTCT
ACCGTGCCGCTAGCGGAGCCCAGCATCGGCACAACCATTGTCCAGGGCGGGCGCAGGACGAAGACGTCGCAGGAG
CGCAAGATTGAACAAGAACGCCGCGAGTACGAAGAAACAAACCTGGTGCGCTTGCCCAAGGCCAGCAAGAAGGAG
CGCGCCAAGATGAAGCAGCAGGCGGGGCGCAGCCGGCGCATGCAGTTTGGCGGCGAGGACTGGCACGAGTTGGGC
GAGGGCGTCGACCGCATCGACCGCCTTACCAAGCGCAAAGGTCCGGCCGAAGGCAATGTGCGCGCCCTGCTGGAA
AAGAGCCGCAAACGTGGCATGGACACGACGGATGGGCCCCGAGGCAGCGGCCAGGGAGTCGAGATTGGAGAGAGA
TTTCGCAAAAAAGTCAAGACTATGAAGAGGAGCAAAATGTGGTAG
Gene >OphauG2|2933
ATGGCAGCGCCCACCACCTTGTCGGCTCTTCTGACTTGGTTGAACCAGTCATTGTCGCTTGCTCAGGAGGCGACG
CCAAAACTAGAGGAATACAAGCACCCCCAAAATGGCATCTCGCTGCTCGACGTCAAGAACGACTTGCTGCTCTCC
TACTTGCAAAATCTCGTTTTCCTTATCCTTCTCAAGCTGCGAAATGCAAAGTCTGATGGCAACTCAACCGACGCC
CATCAAGAGATTCCCCAAGGTGTTCGCCTGAAGCTAGTCGAACTACGAGTCTATCTGGAAAAGGGTGTTCGGCCG
TTGGAAGAAAAGCTCAAGTTCTCCATTGACCGCTTTCTCCGAACAGCTCAAGATGCACAACGCGAGCAGCAGAAA
AAGAGCACAAAATTGAAAGCCGAGGCCAGGTCTGACGACTCTGACGACTCTGGGTCGGATCGGCATCGTGATGGA
TCTGCATCTGAAAGCAATGATGCAGTAATTGCCGCACCTAGGCCTGGAAGCTTGATAGACGTCGTCTCCATCAAG
CCGGCAGAAGACCAAGACGCGCCGCCTGGTATTTACCGCCCGCCGCGACGAGAACGCAAAGTTATGGAGACGACG
CGGCCGCGCGGAAAAGCCGTTTCCCAACCTCGCCGCTCCCATACCATGGACGAATTTATCAGCGCAGAGCTCTCT
ACCGTGCCGCTAGCGGAGCCCAGCATCGGCACAACCATTGTCCAGGGCGGGCGCAGGACGAAGACGTCGCAGGAG
CGCAAGATTGAACAAGAACGCCGCGAGTACGAAGAAACAAACCTGGTGCGCTTGCCCAAGGCCAGCAAGAAGGAG
CGCGCCAAGATGAAGCAGCAGGCGGGGCGCAGCCGGCGCATGCAGTTTGGCGGCGAGGACTGGCACGAGTTGGGC
GAGGGCGTCGACCGCATCGACCGCCTTACCAAGCGCAAAGGTCCGGCCGAAGGCAATGTGCGCGCCCTGCTGGAA
AAGAGCCGCAAACGTGGCATGGACACGACGGATGGGCCCCGAGGCAGCGGCCAGGGAGTCGAGATTGGAGAGAGA
TTTCGCAAAAAAGTCAAGACTATGAAGAGGAGCAAAATGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail