Protein ID | OphauG2|2930 |
Gene name | |
Location | Contig_2146:41..639 |
Strand | - |
Gene length (bp) | 598 |
Transcript length (bp) | 492 |
Coding sequence length (bp) | 492 |
Protein length (aa) | 164 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.2E-15 | 13 | 80 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.2E-15 | 51 | 114 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.2E-14 | 77 | 146 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 1.3E-09 | 16 | 70 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 6.2E-11 | 50 | 104 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 1.3E-10 | 86 | 137 |
PF00023 | Ank | Ankyrin repeat | 1.5E-06 | 15 | 45 |
PF00023 | Ank | Ankyrin repeat | 7.7E-06 | 51 | 80 |
PF00023 | Ank | Ankyrin repeat | 1.2E-06 | 84 | 114 |
PF00023 | Ank | Ankyrin repeat | 1.4E-04 | 118 | 146 |
PF13606 | Ank_3 | Ankyrin repeat | 2.9E-05 | 15 | 41 |
PF13606 | Ank_3 | Ankyrin repeat | 4.3E-05 | 51 | 75 |
PF13606 | Ank_3 | Ankyrin repeat | 1.1E-05 | 84 | 110 |
PF13606 | Ank_3 | Ankyrin repeat | 1.7E-04 | 118 | 144 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 2 | 158 | 7.0E-23 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 11 | 157 | 3.0E-22 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 11 | 157 | 3.0E-22 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 2 | 158 | 8.0E-22 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 15 | 160 | 4.0E-21 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 2 | 158 | 7.0E-23 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 11 | 157 | 3.0E-22 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 11 | 157 | 3.0E-22 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 2 | 158 | 8.0E-22 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 15 | 160 | 4.0E-21 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 1 | 158 | 4.0E-21 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 9 | 157 | 4.0E-21 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 9 | 158 | 6.0E-21 |
sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 17 | 157 | 9.0E-21 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 1 | 158 | 1.0E-20 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 9 | 157 | 2.0E-20 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 9 | 159 | 2.0E-20 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 9 | 162 | 2.0E-20 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 9 | 159 | 3.0E-20 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 15 | 157 | 3.0E-20 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 16 | 162 | 6.0E-20 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 9 | 159 | 6.0E-20 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 6 | 157 | 7.0E-20 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 9 | 157 | 8.0E-20 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 10 | 159 | 9.0E-20 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 9 | 157 | 1.0E-19 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 16 | 158 | 1.0E-19 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 9 | 159 | 1.0E-19 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 5 | 158 | 1.0E-19 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 9 | 136 | 2.0E-19 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 9 | 157 | 2.0E-19 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 4 | 158 | 2.0E-19 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 9 | 159 | 2.0E-19 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 9 | 159 | 3.0E-19 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 9 | 159 | 3.0E-19 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 9 | 157 | 3.0E-19 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 9 | 157 | 4.0E-19 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 17 | 157 | 4.0E-19 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 15 | 159 | 5.0E-19 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 15 | 160 | 6.0E-19 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 41 | 159 | 7.0E-19 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 41 | 159 | 7.0E-19 |
sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 9 | 162 | 7.0E-19 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 9 | 154 | 9.0E-19 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 9 | 137 | 1.0E-18 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 9 | 162 | 1.0E-18 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 18 | 158 | 1.0E-18 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 18 | 160 | 1.0E-18 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 7 | 154 | 1.0E-18 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 16 | 148 | 2.0E-18 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 9 | 157 | 2.0E-18 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 9 | 162 | 2.0E-18 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 7 | 157 | 3.0E-18 |
sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 15 | 157 | 3.0E-18 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 10 | 158 | 3.0E-18 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 9 | 159 | 4.0E-18 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 16 | 159 | 4.0E-18 |
sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 15 | 154 | 4.0E-18 |
sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 9 | 136 | 5.0E-18 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 16 | 159 | 6.0E-18 |
sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 16 | 157 | 7.0E-18 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 9 | 143 | 8.0E-18 |
sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 15 | 157 | 8.0E-18 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 16 | 157 | 8.0E-18 |
sp|Q5UQI7|YR838_MIMIV | Putative ankyrin repeat protein R838 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R838 PE=3 SV=1 | 15 | 143 | 8.0E-18 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 9 | 160 | 9.0E-18 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 17 | 157 | 1.0E-17 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 9 | 157 | 1.0E-17 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 16 | 159 | 1.0E-17 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 19 | 162 | 1.0E-17 |
sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 17 | 153 | 1.0E-17 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 16 | 157 | 1.0E-17 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 9 | 157 | 1.0E-17 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 15 | 160 | 1.0E-17 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 9 | 146 | 1.0E-17 |
sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 15 | 157 | 1.0E-17 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 9 | 159 | 2.0E-17 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 9 | 149 | 2.0E-17 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 9 | 159 | 2.0E-17 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 9 | 149 | 2.0E-17 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 16 | 154 | 2.0E-17 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 16 | 154 | 2.0E-17 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 13 | 159 | 2.0E-17 |
sp|Q5UP11|YR848_MIMIV | Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 | 19 | 145 | 2.0E-17 |
sp|A7E2S9|A30BL_HUMAN | Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 | 1 | 145 | 2.0E-17 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 15 | 160 | 2.0E-17 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 9 | 157 | 2.0E-17 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 9 | 157 | 3.0E-17 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 9 | 154 | 3.0E-17 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 16 | 157 | 3.0E-17 |
sp|Q5UPE2|YL063_MIMIV | Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 | 19 | 145 | 3.0E-17 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 18 | 157 | 4.0E-17 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 16 | 148 | 4.0E-17 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 9 | 157 | 4.0E-17 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 6 | 157 | 4.0E-17 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 16 | 160 | 5.0E-17 |
sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 9 | 147 | 5.0E-17 |
sp|P0CS66|AKR1_CRYNJ | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 | 18 | 161 | 5.0E-17 |
sp|P0CS67|AKR1_CRYNB | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 | 18 | 161 | 5.0E-17 |
sp|Q7Z8U2|AKR1_ASPOR | Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 | 10 | 160 | 5.0E-17 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 11 | 157 | 5.0E-17 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 9 | 157 | 6.0E-17 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 16 | 148 | 7.0E-17 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 9 | 157 | 7.0E-17 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 9 | 158 | 7.0E-17 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 9 | 136 | 7.0E-17 |
sp|P17221|FEM1_CAEEL | Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 | 15 | 154 | 7.0E-17 |
sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 20 | 154 | 8.0E-17 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 9 | 162 | 9.0E-17 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 9 | 146 | 9.0E-17 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 15 | 154 | 1.0E-16 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 10 | 160 | 1.0E-16 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 19 | 147 | 1.0E-16 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 11 | 157 | 1.0E-16 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 15 | 154 | 1.0E-16 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 15 | 154 | 1.0E-16 |
sp|Q5ZM55|FEM1B_CHICK | Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 | 8 | 158 | 1.0E-16 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 15 | 154 | 2.0E-16 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 16 | 160 | 2.0E-16 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 16 | 160 | 2.0E-16 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 18 | 157 | 2.0E-16 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 9 | 157 | 2.0E-16 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 18 | 157 | 2.0E-16 |
sp|P0C6P7|FEM1B_RAT | Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 | 8 | 158 | 2.0E-16 |
sp|Q8N2N9|AN36B_HUMAN | Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 | 10 | 157 | 2.0E-16 |
sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 15 | 154 | 2.0E-16 |
sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 6 | 157 | 2.0E-16 |
sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 6 | 157 | 2.0E-16 |
sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 6 | 157 | 2.0E-16 |
sp|P20749|BCL3_HUMAN | B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 | 16 | 157 | 2.0E-16 |
sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 10 | 154 | 2.0E-16 |
sp|Q5UP11|YR848_MIMIV | Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 | 15 | 147 | 3.0E-16 |
sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 6 | 157 | 3.0E-16 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 18 | 160 | 3.0E-16 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 17 | 157 | 4.0E-16 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 18 | 157 | 4.0E-16 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 18 | 157 | 4.0E-16 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 9 | 156 | 4.0E-16 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 14 | 157 | 4.0E-16 |
sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 6 | 157 | 4.0E-16 |
sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 6 | 157 | 4.0E-16 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 18 | 160 | 4.0E-16 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 9 | 154 | 5.0E-16 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 17 | 154 | 5.0E-16 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 11 | 159 | 5.0E-16 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 9 | 157 | 5.0E-16 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 9 | 157 | 5.0E-16 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 9 | 157 | 5.0E-16 |
sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 6 | 157 | 5.0E-16 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 9 | 157 | 6.0E-16 |
sp|Q5UPE2|YL063_MIMIV | Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 | 19 | 147 | 6.0E-16 |
sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 6 | 157 | 6.0E-16 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 6 | 160 | 6.0E-16 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 6 | 157 | 6.0E-16 |
sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 6 | 157 | 6.0E-16 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 4 | 144 | 7.0E-16 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 6 | 160 | 7.0E-16 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 16 | 158 | 7.0E-16 |
sp|Q4X251|AKR1_ASPFU | Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 | 10 | 160 | 7.0E-16 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 16 | 158 | 7.0E-16 |
sp|Q5UPA2|YL023_MIMIV | Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 | 6 | 145 | 7.0E-16 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 9 | 158 | 8.0E-16 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 19 | 157 | 8.0E-16 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 18 | 145 | 1.0E-15 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 18 | 145 | 1.0E-15 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 9 | 154 | 1.0E-15 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 16 | 157 | 1.0E-15 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 15 | 145 | 1.0E-15 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 16 | 157 | 1.0E-15 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 9 | 157 | 1.0E-15 |
sp|Q5UPA2|YL023_MIMIV | Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 | 15 | 147 | 1.0E-15 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 19 | 159 | 1.0E-15 |
sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 6 | 157 | 1.0E-15 |
sp|Q9BXX3|AN30A_HUMAN | Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 | 17 | 157 | 1.0E-15 |
sp|Q9UK73|FEM1B_HUMAN | Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 | 8 | 158 | 1.0E-15 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 9 | 159 | 1.0E-15 |
sp|Q9Z2G0|FEM1B_MOUSE | Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 | 8 | 158 | 1.0E-15 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 18 | 159 | 2.0E-15 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 41 | 159 | 2.0E-15 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 16 | 157 | 2.0E-15 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 16 | 138 | 2.0E-15 |
sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 9 | 157 | 2.0E-15 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 6 | 160 | 2.0E-15 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 18 | 158 | 2.0E-15 |
sp|Q5UQ08|YR787_MIMIV | Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 | 15 | 142 | 2.0E-15 |
sp|Q9Z2F6|BCL3_MOUSE | B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 | 16 | 162 | 2.0E-15 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 16 | 160 | 2.0E-15 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 11 | 154 | 2.0E-15 |
sp|Q6P9Z4|FEM1A_DANRE | Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 | 15 | 154 | 2.0E-15 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 15 | 157 | 3.0E-15 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 10 | 157 | 3.0E-15 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 15 | 157 | 3.0E-15 |
sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 10 | 157 | 3.0E-15 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 11 | 154 | 3.0E-15 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 9 | 159 | 3.0E-15 |
sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 16 | 144 | 3.0E-15 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 14 | 159 | 4.0E-15 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 9 | 157 | 4.0E-15 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 16 | 157 | 4.0E-15 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 16 | 157 | 4.0E-15 |
sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 5 | 154 | 4.0E-15 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 16 | 160 | 4.0E-15 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 4 | 154 | 4.0E-15 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 4 | 154 | 4.0E-15 |
sp|B0G124|Y9043_DICDI | Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 | 20 | 154 | 4.0E-15 |
sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 14 | 147 | 4.0E-15 |
sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 14 | 147 | 4.0E-15 |
sp|Q09701|AKR1_SCHPO | Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 | 9 | 161 | 4.0E-15 |
sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 14 | 147 | 4.0E-15 |
sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 14 | 147 | 4.0E-15 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 17 | 146 | 5.0E-15 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 16 | 158 | 5.0E-15 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 9 | 157 | 5.0E-15 |
sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 9 | 154 | 5.0E-15 |
sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 9 | 148 | 5.0E-15 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 11 | 154 | 6.0E-15 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 9 | 154 | 6.0E-15 |
sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 17 | 157 | 6.0E-15 |
sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 17 | 157 | 6.0E-15 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 18 | 145 | 6.0E-15 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 9 | 157 | 6.0E-15 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 9 | 157 | 7.0E-15 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 9 | 154 | 7.0E-15 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 9 | 156 | 7.0E-15 |
sp|Q9GL21|UACA_CANLF | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 | 16 | 143 | 7.0E-15 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 15 | 154 | 7.0E-15 |
sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 17 | 157 | 7.0E-15 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 36 | 159 | 8.0E-15 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 23 | 143 | 8.0E-15 |
sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 17 | 157 | 8.0E-15 |
sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 9 | 145 | 8.0E-15 |
sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 9 | 157 | 8.0E-15 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 18 | 145 | 9.0E-15 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 16 | 157 | 9.0E-15 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 9 | 154 | 9.0E-15 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 9 | 157 | 9.0E-15 |
sp|Q8HYY4|UACA_BOVIN | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 | 16 | 143 | 9.0E-15 |
sp|Q08E43|ASB8_BOVIN | Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 | 31 | 154 | 9.0E-15 |
sp|Q91ZT9|ASB8_MOUSE | Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 | 31 | 154 | 9.0E-15 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 9 | 157 | 1.0E-14 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 17 | 146 | 1.0E-14 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 9 | 138 | 1.0E-14 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 15 | 158 | 1.0E-14 |
sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 16 | 157 | 1.0E-14 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 10 | 157 | 1.0E-14 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 9 | 152 | 1.0E-14 |
sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 23 | 162 | 1.0E-14 |
sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 9 | 145 | 1.0E-14 |
sp|Q9BZF9|UACA_HUMAN | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 | 16 | 143 | 1.0E-14 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 11 | 157 | 1.0E-14 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 9 | 152 | 1.0E-14 |
sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 10 | 157 | 1.0E-14 |
sp|Q9J502|V233_FOWPN | Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 | 9 | 154 | 1.0E-14 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 18 | 142 | 2.0E-14 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 18 | 142 | 2.0E-14 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 15 | 157 | 2.0E-14 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 17 | 154 | 2.0E-14 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 17 | 154 | 2.0E-14 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 18 | 145 | 2.0E-14 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 18 | 157 | 2.0E-14 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 15 | 157 | 2.0E-14 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 6 | 143 | 2.0E-14 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 4 | 144 | 2.0E-14 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 18 | 155 | 2.0E-14 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 52 | 159 | 2.0E-14 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 11 | 157 | 2.0E-14 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 9 | 147 | 2.0E-14 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 9 | 157 | 2.0E-14 |
sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 15 | 154 | 2.0E-14 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 11 | 154 | 2.0E-14 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 23 | 157 | 2.0E-14 |
sp|Q5UR04|YR911_MIMIV | Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 | 14 | 141 | 2.0E-14 |
sp|Q5UR04|YR911_MIMIV | Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 | 14 | 147 | 2.0E-14 |
sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 9 | 158 | 2.0E-14 |
sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 15 | 154 | 2.0E-14 |
sp|Q9TU71|ANKR1_RABIT | Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 | 10 | 157 | 2.0E-14 |
sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 15 | 154 | 2.0E-14 |
sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 17 | 153 | 2.0E-14 |
sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 16 | 147 | 2.0E-14 |
sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 10 | 157 | 2.0E-14 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 11 | 154 | 2.0E-14 |
sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 10 | 157 | 2.0E-14 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 9 | 157 | 2.0E-14 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 18 | 159 | 3.0E-14 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 16 | 157 | 3.0E-14 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 9 | 159 | 3.0E-14 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 9 | 158 | 3.0E-14 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 15 | 157 | 3.0E-14 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 19 | 139 | 3.0E-14 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 16 | 157 | 3.0E-14 |
sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 17 | 157 | 3.0E-14 |
sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 10 | 157 | 3.0E-14 |
sp|Q38998|AKT1_ARATH | Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 | 10 | 157 | 3.0E-14 |
sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 10 | 157 | 3.0E-14 |
sp|Q5UQZ7|YR901_MIMIV | Putative ankyrin repeat protein R901 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R901 PE=3 SV=1 | 14 | 147 | 3.0E-14 |
sp|Q5R6D7|ASB8_PONAB | Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 | 31 | 154 | 3.0E-14 |
sp|Q9H765|ASB8_HUMAN | Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 | 31 | 154 | 3.0E-14 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 9 | 142 | 3.0E-14 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 17 | 154 | 4.0E-14 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 15 | 157 | 4.0E-14 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 9 | 157 | 4.0E-14 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 1 | 154 | 4.0E-14 |
sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 31 | 154 | 4.0E-14 |
sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 17 | 163 | 4.0E-14 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 17 | 157 | 4.0E-14 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 9 | 157 | 5.0E-14 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 9 | 157 | 5.0E-14 |
sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 16 | 143 | 5.0E-14 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 9 | 155 | 5.0E-14 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 6 | 147 | 5.0E-14 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 16 | 157 | 5.0E-14 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 16 | 146 | 5.0E-14 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 16 | 157 | 5.0E-14 |
sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 10 | 157 | 5.0E-14 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 17 | 154 | 5.0E-14 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 20 | 159 | 6.0E-14 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 9 | 159 | 6.0E-14 |
sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 50 | 157 | 6.0E-14 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 6.0E-14 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 16 | 143 | 6.0E-14 |
sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 16 | 136 | 6.0E-14 |
sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 16 | 136 | 6.0E-14 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 6.0E-14 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 2 | 158 | 6.0E-14 |
sp|Q5UPE3|YL062_MIMIV | Putative ankyrin repeat protein L62 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L62 PE=3 SV=1 | 13 | 147 | 6.0E-14 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 10 | 158 | 7.0E-14 |
sp|Q5UP19|YR864_MIMIV | Putative ankyrin repeat protein R864 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L864 PE=3 SV=1 | 13 | 151 | 7.0E-14 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 16 | 154 | 8.0E-14 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 9 | 157 | 8.0E-14 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 9 | 157 | 8.0E-14 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 15 | 158 | 8.0E-14 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 17 | 152 | 8.0E-14 |
sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 16 | 143 | 8.0E-14 |
sp|Q7T3P8|FEM1C_DANRE | Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 | 9 | 136 | 8.0E-14 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 10 | 157 | 9.0E-14 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 9 | 157 | 9.0E-14 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 9 | 144 | 9.0E-14 |
sp|Q6AWW5|Y5262_ARATH | Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 | 15 | 157 | 9.0E-14 |
sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 19 | 154 | 9.0E-14 |
sp|Q5UQF1|YL483_MIMIV | Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 | 14 | 145 | 9.0E-14 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 9 | 154 | 1.0E-13 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 15 | 157 | 1.0E-13 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 15 | 157 | 1.0E-13 |
sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 16 | 139 | 1.0E-13 |
sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 17 | 152 | 1.0E-13 |
sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 17 | 152 | 1.0E-13 |
sp|P20749|BCL3_HUMAN | B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 | 15 | 127 | 1.0E-13 |
sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 23 | 162 | 1.0E-13 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 16 | 143 | 1.0E-13 |
sp|Q6P9Z4|FEM1A_DANRE | Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 | 9 | 139 | 1.0E-13 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 16 | 143 | 1.0E-13 |
sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 12 | 154 | 1.0E-13 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 16 | 142 | 1.0E-13 |
sp|Q99PE2|ANRA2_MOUSE | Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 | 6 | 138 | 1.0E-13 |
sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 6 | 144 | 1.0E-13 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 16 | 142 | 1.0E-13 |
sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 10 | 154 | 1.0E-13 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 9 | 154 | 1.0E-13 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 20 | 154 | 1.0E-13 |
sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 9 | 154 | 1.0E-13 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 32 | 142 | 1.0E-13 |
sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 17 | 157 | 1.0E-13 |
sp|Q8C0T1|FM1AB_MOUSE | Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 | 16 | 154 | 1.0E-13 |
sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 15 | 154 | 1.0E-13 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 16 | 157 | 2.0E-13 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 9 | 157 | 2.0E-13 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 18 | 158 | 2.0E-13 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 10 | 158 | 2.0E-13 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 15 | 157 | 2.0E-13 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 9 | 159 | 2.0E-13 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 10 | 154 | 2.0E-13 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 15 | 152 | 2.0E-13 |
sp|Q5UPE2|YL063_MIMIV | Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 | 13 | 147 | 2.0E-13 |
sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 9 | 136 | 2.0E-13 |
sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 9 | 136 | 2.0E-13 |
sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 16 | 136 | 2.0E-13 |
sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 20 | 159 | 2.0E-13 |
sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 9 | 157 | 2.0E-13 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 17 | 157 | 2.0E-13 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 2.0E-13 |
sp|Q8H569|AKT3_ORYSJ | Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 | 10 | 157 | 2.0E-13 |
sp|Q6NSI1|AR26L_HUMAN | Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 | 17 | 149 | 2.0E-13 |
sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 9 | 138 | 2.0E-13 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 9 | 162 | 2.0E-13 |
sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 9 | 154 | 2.0E-13 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 17 | 157 | 2.0E-13 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 15 | 145 | 2.0E-13 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 17 | 159 | 3.0E-13 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 9 | 157 | 3.0E-13 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 5 | 147 | 3.0E-13 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 9 | 157 | 3.0E-13 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 4 | 157 | 3.0E-13 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 17 | 152 | 3.0E-13 |
sp|Q5UQ08|YR787_MIMIV | Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 | 20 | 147 | 3.0E-13 |
sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 9 | 136 | 3.0E-13 |
sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 9 | 157 | 3.0E-13 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 16 | 144 | 3.0E-13 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 50 | 156 | 3.0E-13 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 9 | 158 | 3.0E-13 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 50 | 156 | 3.0E-13 |
sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 9 | 154 | 3.0E-13 |
sp|Q5B0V6|AKR1_EMENI | Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 | 10 | 160 | 3.0E-13 |
sp|Q2KI79|ANRA2_BOVIN | Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 | 6 | 138 | 3.0E-13 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 10 | 157 | 3.0E-13 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 20 | 162 | 3.0E-13 |
sp|Q9UPS8|ANR26_HUMAN | Ankyrin repeat domain-containing protein 26 OS=Homo sapiens GN=ANKRD26 PE=1 SV=3 | 9 | 145 | 3.0E-13 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 17 | 157 | 3.0E-13 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 16 | 157 | 4.0E-13 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 9 | 144 | 4.0E-13 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 10 | 157 | 4.0E-13 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 16 | 158 | 4.0E-13 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 16 | 114 | 4.0E-13 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 10 | 158 | 4.0E-13 |
sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 20 | 159 | 4.0E-13 |
sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 18 | 155 | 4.0E-13 |
sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 17 | 157 | 4.0E-13 |
sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 9 | 157 | 4.0E-13 |
sp|Q9H9E1|ANRA2_HUMAN | Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 | 6 | 138 | 4.0E-13 |
sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 17 | 163 | 4.0E-13 |
sp|Q811D2|ANR26_MOUSE | Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 | 9 | 145 | 4.0E-13 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 9 | 154 | 4.0E-13 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 17 | 157 | 4.0E-13 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 17 | 157 | 4.0E-13 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 1 | 153 | 4.0E-13 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 15 | 157 | 5.0E-13 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 15 | 157 | 5.0E-13 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 17 | 157 | 5.0E-13 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 16 | 157 | 5.0E-13 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 15 | 138 | 5.0E-13 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 35 | 157 | 5.0E-13 |
sp|Q5UQZ7|YR901_MIMIV | Putative ankyrin repeat protein R901 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R901 PE=3 SV=1 | 16 | 147 | 5.0E-13 |
sp|Q5UQF1|YL483_MIMIV | Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 | 19 | 141 | 5.0E-13 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 9 | 154 | 5.0E-13 |
sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 12 | 154 | 5.0E-13 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 17 | 157 | 5.0E-13 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 5.0E-13 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 17 | 157 | 5.0E-13 |
sp|Q9NU02|ANKE1_HUMAN | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 | 27 | 159 | 5.0E-13 |
sp|Q9STP8|ACBP2_ARATH | Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 | 56 | 157 | 5.0E-13 |
sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 9 | 154 | 5.0E-13 |
sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 17 | 152 | 6.0E-13 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 9 | 137 | 6.0E-13 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 16 | 143 | 6.0E-13 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 19 | 145 | 6.0E-13 |
sp|Q5UQY4|YR886_MIMIV | Putative ankyrin repeat protein R886 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R886 PE=4 SV=1 | 34 | 157 | 6.0E-13 |
sp|Q108T9|CTTB2_LOXAF | Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 6.0E-13 |
sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 12 | 154 | 7.0E-13 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 18 | 138 | 7.0E-13 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 18 | 138 | 7.0E-13 |
sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 17 | 159 | 7.0E-13 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 16 | 143 | 7.0E-13 |
sp|Q5UPD5|YL059_MIMIV | Putative ankyrin repeat protein L59 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L59 PE=3 SV=1 | 13 | 145 | 7.0E-13 |
sp|Q2KI79|ANRA2_BOVIN | Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 | 52 | 142 | 8.0E-13 |
sp|Q29RM5|FEM1A_BOVIN | Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 | 16 | 154 | 8.0E-13 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 8.0E-13 |
sp|Q5UP39|YR873_MIMIV | Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 | 19 | 143 | 8.0E-13 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 16 | 157 | 9.0E-13 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 9 | 154 | 9.0E-13 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 16 | 114 | 9.0E-13 |
sp|Q99PE2|ANRA2_MOUSE | Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 | 52 | 142 | 9.0E-13 |
sp|Q8H569|AKT3_ORYSJ | Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 | 41 | 143 | 9.0E-13 |
sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 9 | 157 | 9.0E-13 |
sp|Q2QLB3|CTTB2_CALMO | Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 9.0E-13 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 16 | 157 | 1.0E-12 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 9 | 157 | 1.0E-12 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 52 | 154 | 1.0E-12 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 9 | 154 | 1.0E-12 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 16 | 144 | 1.0E-12 |
sp|P17221|FEM1_CAEEL | Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 | 51 | 157 | 1.0E-12 |
sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 17 | 152 | 1.0E-12 |
sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 17 | 159 | 1.0E-12 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 15 | 141 | 1.0E-12 |
sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 12 | 154 | 1.0E-12 |
sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 15 | 157 | 1.0E-12 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 57 | 159 | 1.0E-12 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 20 | 161 | 1.0E-12 |
sp|Q5UQF1|YL483_MIMIV | Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 | 15 | 147 | 1.0E-12 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 14 | 137 | 1.0E-12 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 17 | 158 | 1.0E-12 |
sp|Q9H9E1|ANRA2_HUMAN | Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 | 52 | 142 | 1.0E-12 |
sp|Q6C520|AKR1_YARLI | Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 | 12 | 160 | 1.0E-12 |
sp|Q4I8B6|AKR1_GIBZE | Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 | 15 | 157 | 1.0E-12 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 17 | 157 | 1.0E-12 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 1.0E-12 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 9 | 157 | 1.0E-12 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 52 | 157 | 1.0E-12 |
sp|Q5UNU1|YL675_MIMIV | Putative ankyrin repeat protein L675 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L675 PE=3 SV=1 | 19 | 111 | 1.0E-12 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 1.0E-12 |
sp|Q07DV1|CTTB2_AOTNA | Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 1.0E-12 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 16 | 159 | 2.0E-12 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 4 | 157 | 2.0E-12 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 16 | 158 | 2.0E-12 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 15 | 157 | 2.0E-12 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 31 | 147 | 2.0E-12 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 16 | 157 | 2.0E-12 |
sp|Q5UP11|YR848_MIMIV | Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 | 19 | 144 | 2.0E-12 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 15 | 138 | 2.0E-12 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 12 | 154 | 2.0E-12 |
sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 17 | 152 | 2.0E-12 |
sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 17 | 152 | 2.0E-12 |
sp|Q9Z2F6|BCL3_MOUSE | B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 | 15 | 127 | 2.0E-12 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 15 | 157 | 2.0E-12 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 15 | 157 | 2.0E-12 |
sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 15 | 157 | 2.0E-12 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 9 | 152 | 2.0E-12 |
sp|Q5UQF1|YL483_MIMIV | Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 | 11 | 145 | 2.0E-12 |
sp|Q2IBD4|CTTB2_RAT | Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 | 18 | 154 | 2.0E-12 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 52 | 157 | 2.0E-12 |
sp|Q9J5I7|V014_FOWPN | Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 | 10 | 158 | 2.0E-12 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 18 | 154 | 2.0E-12 |
sp|A6NC57|ANR62_HUMAN | Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 | 9 | 158 | 2.0E-12 |
sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 23 | 154 | 2.0E-12 |
sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 13 | 163 | 2.0E-12 |
sp|Q8GXE6|AKT6_ARATH | Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 | 10 | 157 | 2.0E-12 |
sp|Q5UPA3|YL022_MIMIV | Putative ankyrin repeat protein L22 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L22 PE=3 SV=1 | 15 | 141 | 2.0E-12 |
sp|Q9D2X0|ANR39_MOUSE | Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 | 14 | 106 | 2.0E-12 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 2.0E-12 |
sp|Q5UPU4|YR267_MIMIV | Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 | 15 | 149 | 2.0E-12 |
sp|Q4P6L3|AKR1_USTMA | Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 | 15 | 161 | 2.0E-12 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 1 | 158 | 3.0E-12 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 52 | 154 | 3.0E-12 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 16 | 157 | 3.0E-12 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 16 | 158 | 3.0E-12 |
sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 17 | 152 | 3.0E-12 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 12 | 154 | 3.0E-12 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 9 | 140 | 3.0E-12 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 9 | 157 | 3.0E-12 |
sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 17 | 152 | 3.0E-12 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 9 | 143 | 3.0E-12 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 9 | 143 | 3.0E-12 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 4 | 158 | 3.0E-12 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 2 | 145 | 3.0E-12 |
sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 15 | 157 | 3.0E-12 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 16 | 141 | 3.0E-12 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 9 | 153 | 3.0E-12 |
sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 15 | 154 | 3.0E-12 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 15 | 141 | 3.0E-12 |
sp|Q5UQY4|YR886_MIMIV | Putative ankyrin repeat protein R886 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R886 PE=4 SV=1 | 17 | 134 | 3.0E-12 |
sp|Q9BSK4|FEM1A_HUMAN | Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 | 16 | 154 | 3.0E-12 |
sp|A1X157|CTTB2_ECHTE | Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 3.0E-12 |
sp|Q5UR87|YR634_MIMIV | Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 | 18 | 147 | 3.0E-12 |
sp|Q09YJ3|CTTB2_MUNMU | Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 3.0E-12 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 3.0E-12 |
sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 9 | 154 | 3.0E-12 |
sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 9 | 154 | 3.0E-12 |
sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 16 | 154 | 3.0E-12 |
sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 23 | 157 | 3.0E-12 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 3.0E-12 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 18 | 157 | 4.0E-12 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 18 | 157 | 4.0E-12 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 16 | 157 | 4.0E-12 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 15 | 157 | 4.0E-12 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 9 | 161 | 4.0E-12 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 9 | 154 | 4.0E-12 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 18 | 157 | 4.0E-12 |
sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 16 | 144 | 4.0E-12 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 9 | 157 | 4.0E-12 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 9 | 159 | 4.0E-12 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 9 | 140 | 4.0E-12 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 9 | 140 | 4.0E-12 |
sp|Q6P9Z4|FEM1A_DANRE | Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 | 15 | 157 | 4.0E-12 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 16 | 157 | 4.0E-12 |
sp|Q5UPE3|YL062_MIMIV | Putative ankyrin repeat protein L62 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L62 PE=3 SV=1 | 16 | 143 | 4.0E-12 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 16 | 141 | 4.0E-12 |
sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 17 | 157 | 4.0E-12 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 9 | 144 | 4.0E-12 |
sp|Q09YG9|CTTB2_SAIBB | Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 4.0E-12 |
sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 16 | 154 | 4.0E-12 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 41 | 154 | 4.0E-12 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 4.0E-12 |
sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 9 | 154 | 4.0E-12 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 9 | 157 | 5.0E-12 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 18 | 157 | 5.0E-12 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 9 | 163 | 5.0E-12 |
sp|Q5UPE2|YL063_MIMIV | Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 | 23 | 147 | 5.0E-12 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 16 | 154 | 5.0E-12 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 18 | 143 | 5.0E-12 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 2 | 144 | 5.0E-12 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 2 | 144 | 5.0E-12 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 20 | 159 | 5.0E-12 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 39 | 160 | 5.0E-12 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 2 | 144 | 5.0E-12 |
sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 15 | 157 | 5.0E-12 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 16 | 141 | 5.0E-12 |
sp|Q5UP39|YR873_MIMIV | Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 | 19 | 147 | 5.0E-12 |
sp|Q5UR87|YR634_MIMIV | Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 | 23 | 147 | 5.0E-12 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 9 | 156 | 5.0E-12 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 20 | 161 | 5.0E-12 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 9 | 153 | 5.0E-12 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 18 | 154 | 5.0E-12 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 9 | 159 | 6.0E-12 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 9 | 159 | 6.0E-12 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 16 | 157 | 6.0E-12 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 9 | 159 | 6.0E-12 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 9 | 157 | 6.0E-12 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 15 | 157 | 6.0E-12 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 51 | 159 | 6.0E-12 |
sp|Q6P9Z4|FEM1A_DANRE | Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 | 15 | 157 | 6.0E-12 |
sp|Q08E43|ASB8_BOVIN | Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 | 35 | 161 | 6.0E-12 |
sp|Q91ZT9|ASB8_MOUSE | Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 | 35 | 161 | 6.0E-12 |
sp|Q5R6D7|ASB8_PONAB | Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 | 35 | 161 | 6.0E-12 |
sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 23 | 146 | 6.0E-12 |
sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 23 | 146 | 6.0E-12 |
sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 9 | 162 | 6.0E-12 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 16 | 141 | 6.0E-12 |
sp|Q5UP39|YR873_MIMIV | Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 | 13 | 147 | 6.0E-12 |
sp|Q5UP14|YR845_MIMIV | Putative ankyrin repeat protein R845 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R845 PE=3 SV=1 | 15 | 141 | 6.0E-12 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 9 | 158 | 6.0E-12 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 18 | 154 | 6.0E-12 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 6.0E-12 |
sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 17 | 157 | 6.0E-12 |
sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 18 | 162 | 6.0E-12 |
sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 9 | 157 | 6.0E-12 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 9 | 159 | 7.0E-12 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 16 | 147 | 7.0E-12 |
sp|Q5UQI7|YR838_MIMIV | Putative ankyrin repeat protein R838 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R838 PE=3 SV=1 | 48 | 148 | 7.0E-12 |
sp|Q5UPE2|YL063_MIMIV | Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 | 15 | 148 | 7.0E-12 |
sp|Q9H765|ASB8_HUMAN | Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 | 35 | 161 | 7.0E-12 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 7.0E-12 |
sp|Q0P5B9|ANR39_BOVIN | Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 | 9 | 105 | 7.0E-12 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 7.0E-12 |
sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 17 | 152 | 8.0E-12 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 16 | 159 | 8.0E-12 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 9 | 147 | 8.0E-12 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 16 | 157 | 8.0E-12 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 16 | 157 | 8.0E-12 |
sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 35 | 161 | 8.0E-12 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 9 | 157 | 8.0E-12 |
sp|Q8N9B4|ANR42_HUMAN | Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 | 16 | 139 | 8.0E-12 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 16 | 158 | 9.0E-12 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 16 | 157 | 9.0E-12 |
sp|Q7T3P8|FEM1C_DANRE | Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 | 15 | 154 | 9.0E-12 |
sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 12 | 157 | 9.0E-12 |
sp|Q9SCX5|AKT5_ARATH | Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 | 10 | 157 | 9.0E-12 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 16 | 157 | 1.0E-11 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 3 | 154 | 1.0E-11 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 16 | 157 | 1.0E-11 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 3 | 154 | 1.0E-11 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 20 | 159 | 1.0E-11 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 15 | 154 | 1.0E-11 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 4 | 157 | 1.0E-11 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 18 | 157 | 1.0E-11 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 9 | 154 | 1.0E-11 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 9 | 157 | 1.0E-11 |
sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 17 | 152 | 1.0E-11 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 19 | 146 | 1.0E-11 |
sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 9 | 154 | 1.0E-11 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 15 | 157 | 1.0E-11 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 15 | 157 | 1.0E-11 |
sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 9 | 157 | 1.0E-11 |
sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 9 | 154 | 1.0E-11 |
sp|Q9GL21|UACA_CANLF | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 | 15 | 156 | 1.0E-11 |
sp|Q8HYY4|UACA_BOVIN | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 | 15 | 156 | 1.0E-11 |
sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 15 | 138 | 1.0E-11 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 2 | 144 | 1.0E-11 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 9 | 158 | 1.0E-11 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 9 | 141 | 1.0E-11 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 9 | 141 | 1.0E-11 |
sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 23 | 154 | 1.0E-11 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 15 | 145 | 1.0E-11 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 15 | 145 | 1.0E-11 |
sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 9 | 154 | 1.0E-11 |
sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 9 | 154 | 1.0E-11 |
sp|Q5UP39|YR873_MIMIV | Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 | 19 | 147 | 1.0E-11 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 16 | 141 | 1.0E-11 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 1.0E-11 |
sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 16 | 155 | 1.0E-11 |
sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 11 | 139 | 1.0E-11 |
sp|Q876L5|AKR1_SACU7 | Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 | 18 | 146 | 1.0E-11 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 16 | 158 | 1.0E-11 |
sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 15 | 160 | 1.0E-11 |
sp|B4E2M5|ANR66_HUMAN | Ankyrin repeat domain-containing protein 66 OS=Homo sapiens GN=ANKRD66 PE=2 SV=2 | 18 | 149 | 1.0E-11 |
sp|Q53RE8|ANR39_HUMAN | Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 | 14 | 105 | 1.0E-11 |
sp|Q00PJ3|ASZ1_ATEAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 | 16 | 153 | 1.0E-11 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 1.0E-11 |
sp|Q09YJ5|ASZ1_MUNMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 | 9 | 153 | 1.0E-11 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 15 | 141 | 2.0E-11 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 9 | 143 | 2.0E-11 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 15 | 154 | 2.0E-11 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 9 | 154 | 2.0E-11 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 9 | 157 | 2.0E-11 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 16 | 157 | 2.0E-11 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 2 | 144 | 2.0E-11 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 15 | 158 | 2.0E-11 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 15 | 158 | 2.0E-11 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 9 | 158 | 2.0E-11 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 9 | 147 | 2.0E-11 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 17 | 160 | 2.0E-11 |
sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 9 | 154 | 2.0E-11 |
sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 9 | 154 | 2.0E-11 |
sp|Q9J502|V233_FOWPN | Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 | 10 | 121 | 2.0E-11 |
sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 15 | 159 | 2.0E-11 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 18 | 157 | 2.0E-11 |
sp|Q5UR04|YR911_MIMIV | Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 | 14 | 147 | 2.0E-11 |
sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 15 | 159 | 2.0E-11 |
sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 15 | 159 | 2.0E-11 |
sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 15 | 156 | 2.0E-11 |
sp|Q7T3P8|FEM1C_DANRE | Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 | 15 | 159 | 2.0E-11 |
sp|Q5UQF1|YL483_MIMIV | Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 | 14 | 144 | 2.0E-11 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 32 | 157 | 2.0E-11 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 9 | 157 | 2.0E-11 |
sp|Q8C0T1|FM1AB_MOUSE | Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 | 9 | 139 | 2.0E-11 |
sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 23 | 146 | 2.0E-11 |
sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 15 | 157 | 2.0E-11 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 16 | 141 | 2.0E-11 |
sp|Q108T9|CTTB2_LOXAF | Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 | 9 | 153 | 2.0E-11 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 9 | 153 | 2.0E-11 |
sp|Q5UR87|YR634_MIMIV | Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 | 18 | 147 | 2.0E-11 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 9 | 158 | 2.0E-11 |
sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 15 | 154 | 2.0E-11 |
sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 18 | 157 | 2.0E-11 |
sp|Q4ULZ2|Y580_RICFE | Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 | 14 | 154 | 2.0E-11 |
sp|Q09YK4|CTTB2_ATEGE | Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 | 18 | 152 | 2.0E-11 |
sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 23 | 157 | 2.0E-11 |
sp|Q5UPH0|YL100_MIMIV | Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 | 22 | 149 | 2.0E-11 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 32 | 154 | 2.0E-11 |
sp|Q14DN9|AKD1B_MOUSE | Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 | 9 | 158 | 2.0E-11 |
sp|Q5UPB6|YL045_MIMIV | Putative ankyrin repeat protein L45 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L45 PE=3 SV=1 | 19 | 145 | 2.0E-11 |
sp|Q9D738|ASB12_MOUSE | Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 | 86 | 157 | 2.0E-11 |
sp|P39010|AKR1_YEAST | Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 | 18 | 146 | 2.0E-11 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 15 | 139 | 3.0E-11 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 7 | 142 | 3.0E-11 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 15 | 154 | 3.0E-11 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 10 | 162 | 3.0E-11 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 51 | 159 | 3.0E-11 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 15 | 158 | 3.0E-11 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 18 | 138 | 3.0E-11 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 17 | 160 | 3.0E-11 |
sp|B0G124|Y9043_DICDI | Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 | 54 | 157 | 3.0E-11 |
sp|Q5UR04|YR911_MIMIV | Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 | 13 | 145 | 3.0E-11 |
sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 15 | 154 | 3.0E-11 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 15 | 152 | 3.0E-11 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 2 | 157 | 3.0E-11 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 9 | 153 | 3.0E-11 |
sp|Q5UP14|YR845_MIMIV | Putative ankyrin repeat protein R845 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R845 PE=3 SV=1 | 11 | 145 | 3.0E-11 |
sp|Q80T11|USH1G_MOUSE | Usher syndrome type-1G protein homolog OS=Mus musculus GN=Ush1g PE=1 SV=1 | 52 | 136 | 3.0E-11 |
sp|Q495M9|USH1G_HUMAN | Usher syndrome type-1G protein OS=Homo sapiens GN=USH1G PE=1 SV=1 | 52 | 136 | 3.0E-11 |
sp|Q9J5A7|V155_FOWPN | Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 | 9 | 154 | 3.0E-11 |
sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 9 | 146 | 3.0E-11 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 9 | 143 | 4.0E-11 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 10 | 162 | 4.0E-11 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 18 | 154 | 4.0E-11 |
sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 54 | 155 | 4.0E-11 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 54 | 155 | 4.0E-11 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 9 | 161 | 4.0E-11 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 16 | 159 | 4.0E-11 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 16 | 155 | 4.0E-11 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 10 | 153 | 4.0E-11 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 52 | 157 | 4.0E-11 |
sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 10 | 157 | 4.0E-11 |
sp|Q8T2Q0|ZDHC6_DICDI | Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 | 9 | 154 | 4.0E-11 |
sp|Q8WMX8|ASZ1_BOVIN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 | 16 | 153 | 4.0E-11 |
sp|Q755Y0|AKR1_ASHGO | Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 | 18 | 160 | 4.0E-11 |
sp|Q07E17|ASZ1_MUSPF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 | 16 | 153 | 4.0E-11 |
sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 9 | 146 | 4.0E-11 |
sp|Q5UQ04|YR791_MIMIV | Putative ankyrin repeat protein R791 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R791 PE=3 SV=1 | 15 | 145 | 4.0E-11 |
sp|Q09YI3|ASZ1_SHEEP | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 | 16 | 153 | 4.0E-11 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 18 | 154 | 5.0E-11 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 51 | 141 | 5.0E-11 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 9 | 157 | 5.0E-11 |
sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 9 | 158 | 5.0E-11 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 11 | 162 | 5.0E-11 |
sp|Q5UP39|YR873_MIMIV | Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 | 13 | 148 | 5.0E-11 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 16 | 154 | 5.0E-11 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 15 | 154 | 5.0E-11 |
sp|A0M8T3|ASZ1_FELCA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 | 16 | 153 | 5.0E-11 |
sp|Q5UPP7|YR760_MIMIV | Putative ankyrin repeat protein R760 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R760 PE=3 SV=1 | 8 | 145 | 5.0E-11 |
sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 23 | 157 | 5.0E-11 |
sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 9 | 157 | 5.0E-11 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 15 | 139 | 6.0E-11 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 18 | 157 | 6.0E-11 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 7 | 142 | 6.0E-11 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 16 | 144 | 6.0E-11 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 16 | 157 | 6.0E-11 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 16 | 159 | 6.0E-11 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 1 | 160 | 6.0E-11 |
sp|Q5UR04|YR911_MIMIV | Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 | 14 | 145 | 6.0E-11 |
sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 7 | 145 | 6.0E-11 |
sp|Q5UNU1|YL675_MIMIV | Putative ankyrin repeat protein L675 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L675 PE=3 SV=1 | 19 | 144 | 6.0E-11 |
sp|Q07DV1|CTTB2_AOTNA | Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 6.0E-11 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 16 | 154 | 6.0E-11 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 15 | 152 | 6.0E-11 |
sp|Q9D738|ASB12_MOUSE | Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 | 52 | 146 | 6.0E-11 |
sp|O00221|IKBE_HUMAN | NF-kappa-B inhibitor epsilon OS=Homo sapiens GN=NFKBIE PE=1 SV=3 | 16 | 153 | 6.0E-11 |
sp|Q8WXK4|ASB12_HUMAN | Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 | 52 | 146 | 6.0E-11 |
sp|Q108U1|ASZ1_LOXAF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 | 16 | 153 | 6.0E-11 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 6.0E-11 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 9 | 143 | 7.0E-11 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 16 | 157 | 7.0E-11 |
sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 28 | 154 | 7.0E-11 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 9 | 153 | 7.0E-11 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 9 | 158 | 7.0E-11 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 9 | 157 | 8.0E-11 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 9 | 157 | 8.0E-11 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 9 | 157 | 8.0E-11 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 4 | 159 | 8.0E-11 |
sp|Q5UQF1|YL483_MIMIV | Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 | 4 | 147 | 8.0E-11 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 23 | 157 | 8.0E-11 |
sp|Q09YG9|CTTB2_SAIBB | Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 8.0E-11 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 16 | 143 | 8.0E-11 |
sp|Q09YK6|ASZ1_ATEGE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 | 16 | 142 | 8.0E-11 |
sp|Q07DV3|ASZ1_AOTNA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 | 9 | 142 | 8.0E-11 |
sp|Q2IBB4|ASZ1_RHIFE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 | 16 | 153 | 8.0E-11 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 10 | 137 | 8.0E-11 |
sp|Q99466|NOTC4_HUMAN | Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 | 6 | 154 | 8.0E-11 |
sp|Q5UQY9|YR896_MIMIV | Putative ankyrin repeat protein R896 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R896 PE=3 SV=1 | 17 | 143 | 8.0E-11 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 20 | 157 | 8.0E-11 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 9 | 161 | 9.0E-11 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 18 | 136 | 9.0E-11 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 16 | 157 | 9.0E-11 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 4 | 159 | 9.0E-11 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 16 | 144 | 9.0E-11 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 23 | 157 | 9.0E-11 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 52 | 157 | 9.0E-11 |
sp|Q09YJ3|CTTB2_MUNMU | Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 | 9 | 156 | 9.0E-11 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 9 | 151 | 9.0E-11 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 9.0E-11 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 9.0E-11 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 18 | 154 | 9.0E-11 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 4 | 158 | 1.0E-10 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 9 | 161 | 1.0E-10 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 1 | 158 | 1.0E-10 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 9 | 161 | 1.0E-10 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 15 | 157 | 1.0E-10 |
sp|Q5UPE2|YL063_MIMIV | Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 | 19 | 143 | 1.0E-10 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 16 | 157 | 1.0E-10 |
sp|Q5UQ08|YR787_MIMIV | Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 | 15 | 147 | 1.0E-10 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 16 | 144 | 1.0E-10 |
sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 17 | 152 | 1.0E-10 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 9 | 159 | 1.0E-10 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 16 | 154 | 1.0E-10 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 16 | 154 | 1.0E-10 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 9 | 153 | 1.0E-10 |
sp|Q9J5I7|V014_FOWPN | Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 | 10 | 146 | 1.0E-10 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 9 | 137 | 1.0E-10 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 1.0E-10 |
sp|Q14DN9|AKD1B_MOUSE | Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 | 15 | 158 | 1.0E-10 |
sp|Q8WXK4|ASB12_HUMAN | Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 | 86 | 158 | 1.0E-10 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 10 | 137 | 1.0E-10 |
sp|Q9TZC4|ILKH_CAEEL | Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 | 20 | 140 | 1.0E-10 |
sp|Q09YN0|ASZ1_RABIT | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 | 16 | 153 | 1.0E-10 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 10 | 137 | 1.0E-10 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 52 | 142 | 1.0E-10 |
sp|Q2QLG0|ASZ1_CALJA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 | 16 | 142 | 1.0E-10 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 1 | 137 | 1.0E-10 |
sp|Q6GQW0|BTBDB_MOUSE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 OS=Mus musculus GN=Btbd11 PE=2 SV=2 | 9 | 139 | 1.0E-10 |
sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 9 | 154 | 1.0E-10 |
sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 32 | 144 | 1.0E-10 |
sp|Q5UQI8|YR837_MIMIV | Putative ankyrin repeat protein R837 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R837 PE=3 SV=1 | 18 | 143 | 1.0E-10 |
sp|Q2IBE3|ASZ1_PONAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 | 9 | 142 | 1.0E-10 |
sp|Q09YH1|ASZ1_SAIBB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 | 16 | 142 | 1.0E-10 |
sp|Q2IBF5|ASZ1_GORGO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 | 9 | 142 | 1.0E-10 |
sp|Q2IBB1|ASZ1_CHLAE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 | 9 | 142 | 1.0E-10 |
sp|Q8WMX6|ASZ1_PANTR | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 | 9 | 142 | 1.0E-10 |
sp|Q07E30|ASZ1_NEONE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 | 16 | 153 | 1.0E-10 |
sp|A6QL63|BTBDB_HUMAN | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 OS=Homo sapiens GN=BTBD11 PE=2 SV=3 | 9 | 139 | 1.0E-10 |
sp|Q8WMX7|ASZ1_PAPAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 | 9 | 142 | 1.0E-10 |
sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 9 | 154 | 1.0E-10 |
sp|Q07DX6|ASZ1_NOMLE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 | 9 | 142 | 1.0E-10 |
sp|Q8IUH5|ZDH17_HUMAN | Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 | 9 | 161 | 1.0E-10 |
sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 6 | 154 | 1.0E-10 |
sp|P77736|YAHD_ECOLI | Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 | 9 | 157 | 1.0E-10 |
sp|Q9J5I3|V018_FOWPN | Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 | 31 | 143 | 1.0E-10 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 15 | 145 | 1.0E-10 |
sp|Q5UPR3|YR777_MIMIV | Putative ankyrin repeat protein R777 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R777 PE=3 SV=1 | 19 | 149 | 1.0E-10 |
sp|Q5ZLC6|ANR10_CHICK | Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 | 17 | 147 | 1.0E-10 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 4 | 159 | 2.0E-10 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 4 | 159 | 2.0E-10 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 16 | 145 | 2.0E-10 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 7 | 142 | 2.0E-10 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 15 | 146 | 2.0E-10 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 13 | 154 | 2.0E-10 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 9 | 143 | 2.0E-10 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 15 | 158 | 2.0E-10 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 15 | 154 | 2.0E-10 |
sp|P0C6P7|FEM1B_RAT | Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 | 15 | 158 | 2.0E-10 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 15 | 158 | 2.0E-10 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 9 | 161 | 2.0E-10 |
sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 16 | 136 | 2.0E-10 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 17 | 143 | 2.0E-10 |
sp|Q9BZF9|UACA_HUMAN | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 | 15 | 156 | 2.0E-10 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 51 | 159 | 2.0E-10 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 9 | 142 | 2.0E-10 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 15 | 158 | 2.0E-10 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 19 | 145 | 2.0E-10 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 19 | 146 | 2.0E-10 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 15 | 157 | 2.0E-10 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 9 | 156 | 2.0E-10 |
sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 9 | 139 | 2.0E-10 |
sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 9 | 139 | 2.0E-10 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 9 | 137 | 2.0E-10 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 2.0E-10 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 9 | 154 | 2.0E-10 |
sp|Q5UQI8|YR837_MIMIV | Putative ankyrin repeat protein R837 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R837 PE=3 SV=1 | 52 | 149 | 2.0E-10 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 1 | 137 | 2.0E-10 |
sp|Q6NLQ8|XB32_ARATH | E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 | 18 | 159 | 2.0E-10 |
sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 9 | 146 | 2.0E-10 |
sp|Q2QLA4|ASZ1_HORSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 | 16 | 153 | 2.0E-10 |
sp|Q91ZT8|ASB9_MOUSE | Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 | 5 | 160 | 2.0E-10 |
sp|Q8WWH4|ASZ1_HUMAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 | 16 | 142 | 2.0E-10 |
sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 1 | 137 | 2.0E-10 |
sp|Q1LVW0|BTBBA_DANRE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-A OS=Danio rerio GN=btbd11a PE=3 SV=2 | 9 | 142 | 2.0E-10 |
sp|Q2QLB5|ASZ1_CALMO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 | 16 | 142 | 2.0E-10 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 20 | 157 | 2.0E-10 |
sp|P14585|LIN12_CAEEL | Protein lin-12 OS=Caenorhabditis elegans GN=lin-12 PE=1 SV=1 | 2 | 133 | 2.0E-10 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 9 | 140 | 3.0E-10 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 16 | 157 | 3.0E-10 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 12 | 139 | 3.0E-10 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 15 | 157 | 3.0E-10 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 17 | 160 | 3.0E-10 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 16 | 157 | 3.0E-10 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 19 | 146 | 3.0E-10 |
sp|Q91ZT9|ASB8_MOUSE | Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 | 16 | 126 | 3.0E-10 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 1 | 157 | 3.0E-10 |
sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 9 | 152 | 3.0E-10 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 14 | 157 | 3.0E-10 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 15 | 146 | 3.0E-10 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 16 | 157 | 3.0E-10 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 52 | 157 | 3.0E-10 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 50 | 163 | 3.0E-10 |
sp|Q9D2X0|ANR39_MOUSE | Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 | 23 | 145 | 3.0E-10 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 3.0E-10 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 7 | 160 | 3.0E-10 |
sp|Q80VM7|ANR24_MOUSE | Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 | 14 | 157 | 3.0E-10 |
sp|Q5UQJ0|YR835_MIMIV | Putative ankyrin repeat protein R835 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R835 PE=3 SV=1 | 23 | 148 | 3.0E-10 |
sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 66 | 157 | 3.0E-10 |
sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 69 | 157 | 3.0E-10 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 9 | 157 | 4.0E-10 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 10 | 145 | 4.0E-10 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 18 | 149 | 4.0E-10 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 31 | 156 | 4.0E-10 |
sp|Q08E43|ASB8_BOVIN | Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 | 16 | 126 | 4.0E-10 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 16 | 144 | 4.0E-10 |
sp|Q8C0T1|FM1AB_MOUSE | Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 | 15 | 157 | 4.0E-10 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 16 | 154 | 4.0E-10 |
sp|Q5UP39|YR873_MIMIV | Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 | 24 | 147 | 4.0E-10 |
sp|Q2QLB3|CTTB2_CALMO | Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 4.0E-10 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 50 | 163 | 4.0E-10 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 9 | 137 | 4.0E-10 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 9 | 121 | 4.0E-10 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 9 | 141 | 4.0E-10 |
sp|A0JNU3|LPP60_MOUSE | 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 | 48 | 159 | 4.0E-10 |
sp|A0JNU3|LPP60_MOUSE | 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 | 66 | 150 | 4.0E-10 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 9 | 159 | 4.0E-10 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 15 | 154 | 4.0E-10 |
sp|Q4JHE0|XB36_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 | 3 | 153 | 4.0E-10 |
sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 69 | 157 | 4.0E-10 |
sp|Q91955|MTPN_CHICK | Myotrophin OS=Gallus gallus GN=MTPN PE=3 SV=1 | 54 | 146 | 4.0E-10 |
sp|Q6AFL2|Y958_LEIXX | Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 | 9 | 155 | 4.0E-10 |
sp|O54910|IKBE_MOUSE | NF-kappa-B inhibitor epsilon OS=Mus musculus GN=Nfkbie PE=1 SV=2 | 54 | 157 | 4.0E-10 |
sp|P58546|MTPN_HUMAN | Myotrophin OS=Homo sapiens GN=MTPN PE=1 SV=2 | 54 | 146 | 4.0E-10 |
sp|Q863Z4|MTPN_CANLF | Myotrophin OS=Canis lupus familiaris GN=MTPN PE=3 SV=3 | 54 | 146 | 4.0E-10 |
sp|Q3T0F7|MTPN_BOVIN | Myotrophin OS=Bos taurus GN=MTPN PE=1 SV=3 | 54 | 146 | 4.0E-10 |
sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 57 | 160 | 5.0E-10 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 16 | 145 | 5.0E-10 |
sp|Q5UP11|YR848_MIMIV | Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 | 48 | 145 | 5.0E-10 |
sp|A7E2S9|A30BL_HUMAN | Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 | 51 | 157 | 5.0E-10 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 4 | 157 | 5.0E-10 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 9 | 161 | 5.0E-10 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 16 | 154 | 5.0E-10 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 16 | 154 | 5.0E-10 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 31 | 158 | 5.0E-10 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 18 | 149 | 5.0E-10 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 16 | 147 | 5.0E-10 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 16 | 136 | 5.0E-10 |
sp|Q9NU02|ANKE1_HUMAN | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 | 9 | 157 | 5.0E-10 |
sp|Q00PJ3|ASZ1_ATEAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 | 15 | 136 | 5.0E-10 |
sp|Q8T2Q0|ZDHC6_DICDI | Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 | 17 | 153 | 5.0E-10 |
sp|Q8WXK4|ASB12_HUMAN | Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 | 18 | 142 | 5.0E-10 |
sp|P14585|LIN12_CAEEL | Protein lin-12 OS=Caenorhabditis elegans GN=lin-12 PE=1 SV=1 | 17 | 159 | 5.0E-10 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 52 | 157 | 5.0E-10 |
sp|A6NGH8|ANR61_HUMAN | Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 | 15 | 156 | 5.0E-10 |
sp|P62775|MTPN_RAT | Myotrophin OS=Rattus norvegicus GN=Mtpn PE=1 SV=2 | 54 | 146 | 5.0E-10 |
sp|P62774|MTPN_MOUSE | Myotrophin OS=Mus musculus GN=Mtpn PE=1 SV=2 | 54 | 146 | 5.0E-10 |
sp|O88202|LPP60_RAT | 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 | 66 | 150 | 5.0E-10 |
sp|P46531|NOTC1_HUMAN | Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 | 16 | 153 | 5.0E-10 |
sp|Q9SM23|ACBP1_ARATH | Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 | 56 | 157 | 5.0E-10 |
sp|P0C7A6|BTBBB_DANRE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-B OS=Danio rerio GN=btbd11b PE=3 SV=1 | 52 | 142 | 5.0E-10 |
sp|O14593|RFXK_HUMAN | DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 | 52 | 160 | 5.0E-10 |
sp|Q94CT7|XB31_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 | 15 | 145 | 5.0E-10 |
sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 16 | 136 | 6.0E-10 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 4 | 157 | 6.0E-10 |
sp|Q9UK73|FEM1B_HUMAN | Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 | 15 | 158 | 6.0E-10 |
sp|Q9Z2G0|FEM1B_MOUSE | Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 | 15 | 158 | 6.0E-10 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 17 | 157 | 6.0E-10 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 32 | 160 | 6.0E-10 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 7 | 154 | 6.0E-10 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 39 | 160 | 6.0E-10 |
sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 16 | 157 | 6.0E-10 |
sp|A1X157|CTTB2_ECHTE | Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 | 9 | 141 | 6.0E-10 |
sp|Q8N9B4|ANR42_HUMAN | Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 | 30 | 157 | 6.0E-10 |
sp|Q53RE8|ANR39_HUMAN | Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 | 23 | 145 | 6.0E-10 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 9 | 153 | 6.0E-10 |
sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 9 | 154 | 6.0E-10 |
sp|Q07E43|ASZ1_DASNO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 | 16 | 153 | 6.0E-10 |
sp|P40480|HOS4_YEAST | Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 | 16 | 109 | 6.0E-10 |
sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 6 | 147 | 6.0E-10 |
sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 16 | 153 | 6.0E-10 |
sp|Q94B55|XB31_ARATH | Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 | 9 | 157 | 6.0E-10 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 16 | 157 | 7.0E-10 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 4 | 154 | 7.0E-10 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 4 | 154 | 7.0E-10 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 15 | 158 | 7.0E-10 |
sp|Q5ZM55|FEM1B_CHICK | Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 | 15 | 158 | 7.0E-10 |
sp|Q29RM5|FEM1A_BOVIN | Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 | 9 | 139 | 7.0E-10 |
sp|Q09YK4|CTTB2_ATEGE | Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 7.0E-10 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 15 | 160 | 7.0E-10 |
sp|P0C7A6|BTBBB_DANRE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-B OS=Danio rerio GN=btbd11b PE=3 SV=1 | 9 | 139 | 7.0E-10 |
sp|Q2QLC6|ASZ1_CARPS | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 | 16 | 142 | 7.0E-10 |
sp|G3I6Z6|NOTC1_CRIGR | Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 | 16 | 153 | 7.0E-10 |
sp|Q9J4Z8|V242_FOWPN | Putative ankyrin repeat protein FPV242 OS=Fowlpox virus (strain NVSL) GN=FPV242 PE=3 SV=1 | 18 | 153 | 7.0E-10 |
sp|Q07008|NOTC1_RAT | Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 | 16 | 153 | 7.0E-10 |
sp|Q01705|NOTC1_MOUSE | Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 | 16 | 153 | 7.0E-10 |
sp|P07207|NOTCH_DROME | Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 | 16 | 153 | 7.0E-10 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 9 | 159 | 8.0E-10 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 15 | 141 | 8.0E-10 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 15 | 141 | 8.0E-10 |
sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 9 | 147 | 8.0E-10 |
sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 9 | 147 | 8.0E-10 |
sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 32 | 127 | 8.0E-10 |
sp|Q7T2B9|MTPN_DANRE | Myotrophin OS=Danio rerio GN=mtpn PE=3 SV=1 | 54 | 142 | 8.0E-10 |
sp|Q6KAE5|XB32_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 | 16 | 159 | 8.0E-10 |
sp|Q9Z205|RFXK_MOUSE | DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 | 52 | 160 | 8.0E-10 |
sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 69 | 157 | 8.0E-10 |
sp|Q9J5G9|V034_FOWPN | Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 | 23 | 154 | 8.0E-10 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 16 | 159 | 9.0E-10 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 9 | 161 | 9.0E-10 |
sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 17 | 157 | 9.0E-10 |
sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 9 | 157 | 9.0E-10 |
sp|Q0P5B9|ANR39_BOVIN | Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 | 23 | 145 | 9.0E-10 |
sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 35 | 127 | 9.0E-10 |
sp|O14593|RFXK_HUMAN | DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 | 4 | 138 | 9.0E-10 |
sp|Q07DY6|ASZ1_COLGU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 | 9 | 142 | 9.0E-10 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 8 | 154 | 1.0E-09 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 16 | 154 | 1.0E-09 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 53 | 161 | 1.0E-09 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 4 | 154 | 1.0E-09 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 16 | 145 | 1.0E-09 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 17 | 142 | 1.0E-09 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 9 | 138 | 1.0E-09 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 9 | 138 | 1.0E-09 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 16 | 159 | 1.0E-09 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 18 | 157 | 1.0E-09 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 15 | 154 | 1.0E-09 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 15 | 154 | 1.0E-09 |
sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 31 | 161 | 1.0E-09 |
sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 54 | 145 | 1.0E-09 |
sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 54 | 145 | 1.0E-09 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 20 | 147 | 1.0E-09 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 15 | 141 | 1.0E-09 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 16 | 145 | 1.0E-09 |
sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 7 | 154 | 1.0E-09 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 52 | 159 | 1.0E-09 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 52 | 159 | 1.0E-09 |
sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 16 | 152 | 1.0E-09 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 2 | 144 | 1.0E-09 |
sp|Q9BSK4|FEM1A_HUMAN | Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 | 9 | 139 | 1.0E-09 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 16 | 157 | 1.0E-09 |
sp|Q5UP14|YR845_MIMIV | Putative ankyrin repeat protein R845 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R845 PE=3 SV=1 | 13 | 145 | 1.0E-09 |
sp|Q9D738|ASB12_MOUSE | Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 | 18 | 142 | 1.0E-09 |
sp|Q9TZC4|ILKH_CAEEL | Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 | 54 | 160 | 1.0E-09 |
sp|Q9J5I3|V018_FOWPN | Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 | 31 | 157 | 1.0E-09 |
sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 35 | 127 | 1.0E-09 |
sp|Q9J5G9|V034_FOWPN | Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 | 9 | 161 | 1.0E-09 |
sp|Q10311|YD58_SCHPO | Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 | 9 | 157 | 1.0E-09 |
sp|A1ZBY1|FEM1B_DROME | Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 | 9 | 139 | 1.0E-09 |
sp|Q4FE45|XB33_ARATH | E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 | 18 | 142 | 1.0E-09 |
sp|Q9Y576|ASB1_HUMAN | Ankyrin repeat and SOCS box protein 1 OS=Homo sapiens GN=ASB1 PE=1 SV=1 | 52 | 148 | 1.0E-09 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 20 | 157 | 1.0E-09 |
sp|Q2QL84|ASZ1_MICMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 | 16 | 142 | 1.0E-09 |
sp|Q9J512|V223_FOWPN | Putative ankyrin repeat protein FPV223 OS=Fowlpox virus (strain NVSL) GN=FPV223 PE=3 SV=1 | 31 | 154 | 1.0E-09 |
sp|Q876A6|AKR1_NAUCC | Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 | 18 | 163 | 1.0E-09 |
sp|Q2QLH1|ASZ1_OTOGA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 | 16 | 142 | 1.0E-09 |
sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 9 | 157 | 1.0E-09 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 16 | 159 | 2.0E-09 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 57 | 157 | 2.0E-09 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 44 | 158 | 2.0E-09 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 9 | 139 | 2.0E-09 |
sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 3 | 157 | 2.0E-09 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 16 | 136 | 2.0E-09 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 9 | 138 | 2.0E-09 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 18 | 157 | 2.0E-09 |
sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 14 | 136 | 2.0E-09 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 15 | 157 | 2.0E-09 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 9 | 157 | 2.0E-09 |
sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 54 | 147 | 2.0E-09 |
sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 50 | 161 | 2.0E-09 |
sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 31 | 161 | 2.0E-09 |
sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 31 | 161 | 2.0E-09 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 18 | 137 | 2.0E-09 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 18 | 162 | 2.0E-09 |
sp|Q5R6D7|ASB8_PONAB | Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 | 16 | 126 | 2.0E-09 |
sp|Q9H765|ASB8_HUMAN | Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 | 16 | 126 | 2.0E-09 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 16 | 159 | 2.0E-09 |
sp|Q5UP19|YR864_MIMIV | Putative ankyrin repeat protein R864 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L864 PE=3 SV=1 | 14 | 145 | 2.0E-09 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 16 | 140 | 2.0E-09 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 9 | 135 | 2.0E-09 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 16 | 159 | 2.0E-09 |
sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 52 | 157 | 2.0E-09 |
sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 52 | 157 | 2.0E-09 |
sp|Q5UPH0|YL100_MIMIV | Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 | 19 | 149 | 2.0E-09 |
sp|Q5UPP7|YR760_MIMIV | Putative ankyrin repeat protein R760 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R760 PE=3 SV=1 | 19 | 143 | 2.0E-09 |
sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 16 | 158 | 2.0E-09 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 7 | 160 | 2.0E-09 |
sp|Q5UQJ0|YR835_MIMIV | Putative ankyrin repeat protein R835 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R835 PE=3 SV=1 | 18 | 137 | 2.0E-09 |
sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 35 | 127 | 2.0E-09 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 9 | 155 | 2.0E-09 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 9 | 157 | 2.0E-09 |
sp|A1X154|ASZ1_ECHTE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 | 16 | 153 | 2.0E-09 |
sp|Q2IBG0|ASZ1_EULMM | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 | 16 | 142 | 2.0E-09 |
sp|Q5UP15|YR844_MIMIV | Putative ankyrin repeat protein R844 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R844 PE=3 SV=1 | 20 | 145 | 2.0E-09 |
sp|Q9WV74|ASB1_MOUSE | Ankyrin repeat and SOCS box protein 1 OS=Mus musculus GN=Asb1 PE=2 SV=1 | 52 | 148 | 2.0E-09 |
sp|Q65XV2|XB3_ORYSJ | E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 | 15 | 145 | 2.0E-09 |
sp|Q8N8V4|ANS4B_HUMAN | Ankyrin repeat and SAM domain-containing protein 4B OS=Homo sapiens GN=ANKS4B PE=1 SV=2 | 52 | 136 | 2.0E-09 |
sp|Q875S9|AKR1_LACK1 | Palmitoyltransferase AKR1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=AKR1 PE=3 SV=1 | 18 | 160 | 2.0E-09 |
sp|Q01317|NUC2_NEUCR | Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 | 20 | 160 | 2.0E-09 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 16 | 116 | 3.0E-09 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 2 | 161 | 3.0E-09 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 16 | 136 | 3.0E-09 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 47 | 158 | 3.0E-09 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 9 | 139 | 3.0E-09 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 10 | 136 | 3.0E-09 |
sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 14 | 136 | 3.0E-09 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 85 | 146 | 3.0E-09 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 9 | 157 | 3.0E-09 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 15 | 141 | 3.0E-09 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 54 | 153 | 3.0E-09 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 52 | 142 | 3.0E-09 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 52 | 142 | 3.0E-09 |
sp|Q9NU02|ANKE1_HUMAN | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 | 16 | 134 | 3.0E-09 |
sp|Q6C520|AKR1_YARLI | Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 | 20 | 154 | 3.0E-09 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 9 | 145 | 3.0E-09 |
sp|Q5UPU4|YR267_MIMIV | Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 | 3 | 145 | 3.0E-09 |
sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 32 | 154 | 3.0E-09 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 3.0E-09 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 3.0E-09 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 9 | 137 | 3.0E-09 |
sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 25 | 145 | 3.0E-09 |
sp|P58546|MTPN_HUMAN | Myotrophin OS=Homo sapiens GN=MTPN PE=1 SV=2 | 9 | 79 | 3.0E-09 |
sp|Q863Z4|MTPN_CANLF | Myotrophin OS=Canis lupus familiaris GN=MTPN PE=3 SV=3 | 9 | 79 | 3.0E-09 |
sp|Q3T0F7|MTPN_BOVIN | Myotrophin OS=Bos taurus GN=MTPN PE=1 SV=3 | 9 | 79 | 3.0E-09 |
sp|P62775|MTPN_RAT | Myotrophin OS=Rattus norvegicus GN=Mtpn PE=1 SV=2 | 9 | 79 | 3.0E-09 |
sp|P62774|MTPN_MOUSE | Myotrophin OS=Mus musculus GN=Mtpn PE=1 SV=2 | 9 | 79 | 3.0E-09 |
sp|E9PTT0|ZDH17_RAT | Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 | 9 | 161 | 3.0E-09 |
sp|Q80TN5|ZDH17_MOUSE | Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 | 9 | 161 | 3.0E-09 |
sp|Q9WV71|ASB4_MOUSE | Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 | 14 | 154 | 3.0E-09 |
sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 9 | 159 | 3.0E-09 |
sp|Q8K3X6|ANS4B_MOUSE | Ankyrin repeat and SAM domain-containing protein 4B OS=Mus musculus GN=Anks4b PE=1 SV=1 | 52 | 144 | 3.0E-09 |
sp|O35516|NOTC2_MOUSE | Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 | 16 | 153 | 3.0E-09 |
sp|Q07DZ7|ASZ1_ORNAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 | 16 | 153 | 3.0E-09 |
sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 7 | 140 | 3.0E-09 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 15 | 136 | 3.0E-09 |
sp|Q9J503|V232_FOWPN | Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 | 17 | 157 | 3.0E-09 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 53 | 161 | 4.0E-09 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 16 | 141 | 4.0E-09 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 18 | 157 | 4.0E-09 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 52 | 154 | 4.0E-09 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 52 | 154 | 4.0E-09 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 52 | 154 | 4.0E-09 |
sp|Q7T3P8|FEM1C_DANRE | Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 | 15 | 157 | 4.0E-09 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 9 | 157 | 4.0E-09 |
sp|Q8T2Q0|ZDHC6_DICDI | Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 | 16 | 120 | 4.0E-09 |
sp|G3I6Z6|NOTC1_CRIGR | Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 | 10 | 158 | 4.0E-09 |
sp|Q07008|NOTC1_RAT | Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 | 10 | 158 | 4.0E-09 |
sp|Q01705|NOTC1_MOUSE | Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 | 10 | 158 | 4.0E-09 |
sp|A1ZBY1|FEM1B_DROME | Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 | 10 | 141 | 4.0E-09 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 9 | 157 | 4.0E-09 |
sp|Q86U10|LPP60_HUMAN | 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 | 57 | 150 | 4.0E-09 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 15 | 149 | 4.0E-09 |
sp|Q9QW30|NOTC2_RAT | Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 | 11 | 153 | 4.0E-09 |
sp|Q04721|NOTC2_HUMAN | Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 | 11 | 153 | 4.0E-09 |
sp|Q554E7|ZDHC5_DICDI | Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 | 9 | 152 | 4.0E-09 |
sp|Q6DGX3|ANR54_DANRE | Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 | 54 | 157 | 4.0E-09 |
sp|Q7TQI7|ABTB2_MOUSE | Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Mus musculus GN=Abtb2 PE=1 SV=1 | 9 | 139 | 4.0E-09 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 10 | 137 | 4.0E-09 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 9 | 157 | 4.0E-09 |
sp|Q5UPB9|YL042_MIMIV | Putative ankyrin repeat protein L42 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L42 PE=3 SV=1 | 19 | 145 | 4.0E-09 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 49 | 159 | 5.0E-09 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 16 | 143 | 5.0E-09 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 31 | 159 | 5.0E-09 |
sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 14 | 136 | 5.0E-09 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 18 | 158 | 5.0E-09 |
sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 46 | 148 | 5.0E-09 |
sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 31 | 157 | 5.0E-09 |
sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 16 | 126 | 5.0E-09 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 9 | 154 | 5.0E-09 |
sp|Q5UPD5|YL059_MIMIV | Putative ankyrin repeat protein L59 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L59 PE=3 SV=1 | 4 | 137 | 5.0E-09 |
sp|Q5UNU1|YL675_MIMIV | Putative ankyrin repeat protein L675 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L675 PE=3 SV=1 | 10 | 147 | 5.0E-09 |
sp|Q5UPB6|YL045_MIMIV | Putative ankyrin repeat protein L45 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L45 PE=3 SV=1 | 17 | 109 | 5.0E-09 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 9 | 157 | 5.0E-09 |
sp|A0JNU3|LPP60_MOUSE | 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 | 16 | 136 | 5.0E-09 |
sp|Q9Z205|RFXK_MOUSE | DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 | 9 | 136 | 5.0E-09 |
sp|Q9J512|V223_FOWPN | Putative ankyrin repeat protein FPV223 OS=Fowlpox virus (strain NVSL) GN=FPV223 PE=3 SV=1 | 1 | 137 | 5.0E-09 |
sp|Q01317|NUC2_NEUCR | Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 | 17 | 157 | 5.0E-09 |
sp|O35516|NOTC2_MOUSE | Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 | 9 | 160 | 5.0E-09 |
sp|Q9QW30|NOTC2_RAT | Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 | 9 | 160 | 5.0E-09 |
sp|Q04721|NOTC2_HUMAN | Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 | 9 | 160 | 5.0E-09 |
sp|Q5UPG6|YL092_MIMIV | Putative ankyrin repeat protein L92 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L92 PE=3 SV=1 | 9 | 156 | 5.0E-09 |
sp|Q9HYV6|Y3287_PSEAE | Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 | 24 | 161 | 5.0E-09 |
sp|Q9HLN1|Y196_THEAC | Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 | 17 | 152 | 5.0E-09 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 9 | 158 | 5.0E-09 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 54 | 159 | 6.0E-09 |
sp|Q5UQ08|YR787_MIMIV | Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 | 14 | 142 | 6.0E-09 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 23 | 157 | 6.0E-09 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 7 | 157 | 6.0E-09 |
sp|Q38998|AKT1_ARATH | Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 | 54 | 145 | 6.0E-09 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 52 | 142 | 6.0E-09 |
sp|Q5UP39|YR873_MIMIV | Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 | 18 | 145 | 6.0E-09 |
sp|Q9BSK4|FEM1A_HUMAN | Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 | 52 | 157 | 6.0E-09 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 15 | 160 | 6.0E-09 |
sp|P40480|HOS4_YEAST | Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 | 43 | 142 | 6.0E-09 |
sp|G3I6Z6|NOTC1_CRIGR | Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 | 9 | 145 | 6.0E-09 |
sp|Q07008|NOTC1_RAT | Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 | 9 | 145 | 6.0E-09 |
sp|Q01705|NOTC1_MOUSE | Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 | 9 | 145 | 6.0E-09 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 15 | 160 | 6.0E-09 |
sp|Q6UB99|ANR11_HUMAN | Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 | 2 | 140 | 6.0E-09 |
sp|Q8WXI3|ASB10_HUMAN | Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 | 12 | 157 | 6.0E-09 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 31 | 159 | 7.0E-09 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 9 | 145 | 7.0E-09 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 6 | 131 | 7.0E-09 |
sp|A6NGH8|ANR61_HUMAN | Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 | 25 | 152 | 7.0E-09 |
sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 9 | 157 | 7.0E-09 |
sp|Q6KAE5|XB32_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 | 15 | 124 | 7.0E-09 |
sp|Q9J503|V232_FOWPN | Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 | 31 | 163 | 7.0E-09 |
sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 10 | 154 | 7.0E-09 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 17 | 142 | 8.0E-09 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 15 | 141 | 8.0E-09 |
sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 15 | 157 | 8.0E-09 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 2 | 158 | 8.0E-09 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 4 | 157 | 8.0E-09 |
sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 21 | 136 | 8.0E-09 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 18 | 158 | 8.0E-09 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 9 | 159 | 8.0E-09 |
sp|Q8N961|ABTB2_HUMAN | Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Homo sapiens GN=ABTB2 PE=2 SV=2 | 9 | 109 | 8.0E-09 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 54 | 161 | 9.0E-09 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 53 | 161 | 9.0E-09 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 31 | 159 | 9.0E-09 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 50 | 158 | 9.0E-09 |
sp|Q8C0T1|FM1AB_MOUSE | Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 | 52 | 157 | 9.0E-09 |
sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 9 | 158 | 9.0E-09 |
sp|Q2IBD4|CTTB2_RAT | Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 | 9 | 137 | 9.0E-09 |
sp|Q5UR87|YR634_MIMIV | Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 | 32 | 149 | 9.0E-09 |
sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 15 | 157 | 9.0E-09 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 15 | 158 | 9.0E-09 |
sp|Q80VM7|ANR24_MOUSE | Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 | 16 | 143 | 9.0E-09 |
sp|Q9J504|V231_FOWPN | Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 | 20 | 154 | 9.0E-09 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 54 | 161 | 1.0E-08 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 9 | 145 | 1.0E-08 |
sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 57 | 141 | 1.0E-08 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 12 | 158 | 1.0E-08 |
sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 16 | 136 | 1.0E-08 |
sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 16 | 136 | 1.0E-08 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 16 | 143 | 1.0E-08 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 9 | 141 | 1.0E-08 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 3 | 160 | 1.0E-08 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 15 | 154 | 1.0E-08 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 9 | 135 | 1.0E-08 |
sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 11 | 154 | 1.0E-08 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 9 | 135 | 1.0E-08 |
sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 10 | 146 | 1.0E-08 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 52 | 154 | 1.0E-08 |
sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 9 | 152 | 1.0E-08 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 30 | 155 | 1.0E-08 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 16 | 143 | 1.0E-08 |
sp|Q6GQW0|BTBDB_MOUSE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 OS=Mus musculus GN=Btbd11 PE=2 SV=2 | 52 | 142 | 1.0E-08 |
sp|A6QL63|BTBDB_HUMAN | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 OS=Homo sapiens GN=BTBD11 PE=2 SV=3 | 52 | 142 | 1.0E-08 |
sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 35 | 154 | 1.0E-08 |
sp|Q5UQJ0|YR835_MIMIV | Putative ankyrin repeat protein R835 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R835 PE=3 SV=1 | 32 | 144 | 1.0E-08 |
sp|Q6AFL2|Y958_LEIXX | Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 | 25 | 144 | 1.0E-08 |
sp|P46531|NOTC1_HUMAN | Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 | 10 | 158 | 1.0E-08 |
sp|P46531|NOTC1_HUMAN | Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 | 9 | 145 | 1.0E-08 |
sp|Q876A6|AKR1_NAUCC | Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 | 23 | 158 | 1.0E-08 |
sp|Q01317|NUC2_NEUCR | Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 | 17 | 145 | 1.0E-08 |
sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 16 | 154 | 1.0E-08 |
sp|Q9J504|V231_FOWPN | Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 | 27 | 154 | 1.0E-08 |
sp|Q5UPJ9|YL122_MIMIV | Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 | 19 | 142 | 1.0E-08 |
sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 15 | 162 | 1.0E-08 |
sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 9 | 157 | 1.0E-08 |
sp|Q5UQC4|YR229_MIMIV | Putative ankyrin repeat protein R229 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R229 PE=3 SV=1 | 15 | 148 | 1.0E-08 |
sp|Q5UQC4|YR229_MIMIV | Putative ankyrin repeat protein R229 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R229 PE=3 SV=1 | 30 | 148 | 1.0E-08 |
sp|A0PJZ0|A20A5_HUMAN | Putative ankyrin repeat domain-containing protein 20A5 OS=Homo sapiens GN=ANKRD20A5P PE=5 SV=1 | 17 | 114 | 1.0E-08 |
sp|Q6TNT2|ANR46_DANRE | Ankyrin repeat domain-containing protein 46 OS=Danio rerio GN=ankrd46 PE=2 SV=1 | 52 | 157 | 1.0E-08 |
sp|Q6P1S6|MTPN_XENTR | Myotrophin OS=Xenopus tropicalis GN=mtpn PE=3 SV=1 | 54 | 146 | 1.0E-08 |
sp|Q1RJN6|Y347_RICBR | Putative ankyrin repeat protein RBE_0347 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0347 PE=3 SV=1 | 16 | 110 | 1.0E-08 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 9 | 144 | 2.0E-08 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 16 | 157 | 2.0E-08 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 6 | 107 | 2.0E-08 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 6 | 107 | 2.0E-08 |
sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 14 | 136 | 2.0E-08 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 9 | 136 | 2.0E-08 |
sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 14 | 136 | 2.0E-08 |
sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 14 | 136 | 2.0E-08 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 9 | 154 | 2.0E-08 |
sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 14 | 136 | 2.0E-08 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 16 | 154 | 2.0E-08 |
sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 14 | 136 | 2.0E-08 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 15 | 154 | 2.0E-08 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 9 | 157 | 2.0E-08 |
sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 42 | 141 | 2.0E-08 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 9 | 135 | 2.0E-08 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 18 | 137 | 2.0E-08 |
sp|Q29RM5|FEM1A_BOVIN | Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 | 52 | 157 | 2.0E-08 |
sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 52 | 142 | 2.0E-08 |
sp|Q5UQY9|YR896_MIMIV | Putative ankyrin repeat protein R896 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R896 PE=3 SV=1 | 15 | 112 | 2.0E-08 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 53 | 159 | 2.0E-08 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 16 | 143 | 2.0E-08 |
sp|Q6NLQ8|XB32_ARATH | E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 | 54 | 148 | 2.0E-08 |
sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 16 | 143 | 2.0E-08 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 9 | 155 | 2.0E-08 |
sp|Q91955|MTPN_CHICK | Myotrophin OS=Gallus gallus GN=MTPN PE=3 SV=1 | 9 | 79 | 2.0E-08 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 11 | 156 | 2.0E-08 |
sp|Q7T2B9|MTPN_DANRE | Myotrophin OS=Danio rerio GN=mtpn PE=3 SV=1 | 9 | 79 | 2.0E-08 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 9 | 160 | 2.0E-08 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 9 | 163 | 2.0E-08 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 9 | 152 | 2.0E-08 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 6 | 146 | 2.0E-08 |
sp|Q8WXE0|CSKI2_HUMAN | Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 | 9 | 154 | 2.0E-08 |
sp|A2RUV0|NOTC1_XENTR | Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis GN=notch1 PE=1 SV=2 | 14 | 153 | 2.0E-08 |
sp|Q5R5V4|ILK_PONAB | Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 | 54 | 154 | 2.0E-08 |
sp|Q5R5V4|ILK_PONAB | Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 | 27 | 141 | 2.0E-08 |
sp|Q13418|ILK_HUMAN | Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 | 54 | 154 | 2.0E-08 |
sp|Q13418|ILK_HUMAN | Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 | 27 | 141 | 2.0E-08 |
sp|Q86W74|ANR46_HUMAN | Ankyrin repeat domain-containing protein 46 OS=Homo sapiens GN=ANKRD46 PE=1 SV=1 | 52 | 157 | 2.0E-08 |
sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 54 | 154 | 2.0E-08 |
sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 27 | 154 | 2.0E-08 |
sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 4 | 150 | 2.0E-08 |
sp|P14360|V240_FOWPN | Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 | 7 | 157 | 2.0E-08 |
sp|Q99J82|ILK_RAT | Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 | 54 | 154 | 2.0E-08 |
sp|Q99J82|ILK_RAT | Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 | 27 | 141 | 2.0E-08 |
sp|O55222|ILK_MOUSE | Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 | 54 | 154 | 2.0E-08 |
sp|O55222|ILK_MOUSE | Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 | 27 | 141 | 2.0E-08 |
sp|Q3SWY2|ILK_BOVIN | Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 | 54 | 154 | 2.0E-08 |
sp|Q3SWY2|ILK_BOVIN | Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 | 27 | 141 | 2.0E-08 |
sp|Q3SX00|ANR46_BOVIN | Ankyrin repeat domain-containing protein 46 OS=Bos taurus GN=ANKRD46 PE=2 SV=1 | 52 | 157 | 2.0E-08 |
sp|Q5R8C8|ANR46_PONAB | Ankyrin repeat domain-containing protein 46 OS=Pongo abelii GN=ANKRD46 PE=2 SV=1 | 52 | 157 | 2.0E-08 |
sp|Q8VHK1|CSKI2_MOUSE | Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 | 9 | 154 | 2.0E-08 |
sp|Q61982|NOTC3_MOUSE | Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 | 11 | 158 | 2.0E-08 |
sp|Q9R172|NOTC3_RAT | Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 | 11 | 158 | 2.0E-08 |
sp|Q9UM47|NOTC3_HUMAN | Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 | 11 | 158 | 2.0E-08 |
sp|Q337A0|XB33_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 | 18 | 104 | 2.0E-08 |
sp|O08764|ABTB2_RAT | Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Rattus norvegicus GN=Abtb2 PE=2 SV=1 | 9 | 109 | 2.0E-08 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 16 | 136 | 3.0E-08 |
sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 14 | 136 | 3.0E-08 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 9 | 125 | 3.0E-08 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 18 | 157 | 3.0E-08 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 57 | 157 | 3.0E-08 |
sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 52 | 155 | 3.0E-08 |
sp|Q6NSI1|AR26L_HUMAN | Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 | 20 | 157 | 3.0E-08 |
sp|Q5UPD5|YL059_MIMIV | Putative ankyrin repeat protein L59 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L59 PE=3 SV=1 | 12 | 145 | 3.0E-08 |
sp|A6NC57|ANR62_HUMAN | Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 | 16 | 150 | 3.0E-08 |
sp|Q5UPA3|YL022_MIMIV | Putative ankyrin repeat protein L22 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L22 PE=3 SV=1 | 57 | 147 | 3.0E-08 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 9 | 157 | 3.0E-08 |
sp|A0M8T3|ASZ1_FELCA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 | 15 | 136 | 3.0E-08 |
sp|Q99466|NOTC4_HUMAN | Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 | 16 | 158 | 3.0E-08 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 17 | 143 | 3.0E-08 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 53 | 159 | 3.0E-08 |
sp|A0JNU3|LPP60_MOUSE | 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 | 100 | 157 | 3.0E-08 |
sp|O88202|LPP60_RAT | 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 | 32 | 159 | 3.0E-08 |
sp|Q6KAE5|XB32_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 | 54 | 148 | 3.0E-08 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 15 | 160 | 3.0E-08 |
sp|Q5R5V4|ILK_PONAB | Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 | 4 | 150 | 3.0E-08 |
sp|Q13418|ILK_HUMAN | Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 | 4 | 150 | 3.0E-08 |
sp|Q99J82|ILK_RAT | Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 | 4 | 150 | 3.0E-08 |
sp|O55222|ILK_MOUSE | Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 | 4 | 150 | 3.0E-08 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 16 | 157 | 4.0E-08 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 9 | 157 | 4.0E-08 |
sp|P17221|FEM1_CAEEL | Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 | 1 | 139 | 4.0E-08 |
sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 17 | 139 | 4.0E-08 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 9 | 139 | 4.0E-08 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 9 | 135 | 4.0E-08 |
sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 17 | 157 | 4.0E-08 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 9 | 157 | 4.0E-08 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 9 | 157 | 4.0E-08 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 9 | 157 | 4.0E-08 |
sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 16 | 101 | 4.0E-08 |
sp|Q6KAE5|XB32_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 | 9 | 157 | 4.0E-08 |
sp|Q5UP15|YR844_MIMIV | Putative ankyrin repeat protein R844 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R844 PE=3 SV=1 | 17 | 145 | 4.0E-08 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 9 | 152 | 4.0E-08 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 16 | 141 | 5.0E-08 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 9 | 136 | 5.0E-08 |
sp|B0G124|Y9043_DICDI | Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 | 16 | 138 | 5.0E-08 |
sp|Q811D2|ANR26_MOUSE | Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 | 51 | 157 | 5.0E-08 |
sp|Q9NU02|ANKE1_HUMAN | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 | 17 | 156 | 5.0E-08 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 8 | 156 | 5.0E-08 |
sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 17 | 157 | 5.0E-08 |
sp|Q80T11|USH1G_MOUSE | Usher syndrome type-1G protein homolog OS=Mus musculus GN=Ush1g PE=1 SV=1 | 5 | 103 | 5.0E-08 |
sp|Q495M9|USH1G_HUMAN | Usher syndrome type-1G protein OS=Homo sapiens GN=USH1G PE=1 SV=1 | 5 | 103 | 5.0E-08 |
sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 16 | 101 | 5.0E-08 |
sp|Q8WXI3|ASB10_HUMAN | Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 | 18 | 162 | 5.0E-08 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 16 | 158 | 6.0E-08 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 10 | 141 | 6.0E-08 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 54 | 157 | 6.0E-08 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 54 | 157 | 6.0E-08 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 18 | 137 | 6.0E-08 |
sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 54 | 154 | 6.0E-08 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 32 | 157 | 6.0E-08 |
sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 16 | 134 | 6.0E-08 |
sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 42 | 141 | 6.0E-08 |
sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 54 | 157 | 6.0E-08 |
sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 15 | 136 | 6.0E-08 |
sp|Q2IBB4|ASZ1_RHIFE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 | 15 | 136 | 6.0E-08 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 6 | 163 | 6.0E-08 |
sp|Q1LVW0|BTBBA_DANRE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-A OS=Danio rerio GN=btbd11a PE=3 SV=2 | 84 | 159 | 6.0E-08 |
sp|O35516|NOTC2_MOUSE | Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 | 11 | 158 | 6.0E-08 |
sp|Q8N961|ABTB2_HUMAN | Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Homo sapiens GN=ABTB2 PE=2 SV=2 | 52 | 142 | 6.0E-08 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 18 | 125 | 7.0E-08 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 9 | 154 | 7.0E-08 |
sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 18 | 140 | 7.0E-08 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 17 | 160 | 7.0E-08 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 9 | 125 | 7.0E-08 |
sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 54 | 154 | 7.0E-08 |
sp|P07207|NOTCH_DROME | Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 | 16 | 158 | 7.0E-08 |
sp|Q10311|YD58_SCHPO | Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 | 51 | 154 | 7.0E-08 |
sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 18 | 157 | 8.0E-08 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 51 | 143 | 8.0E-08 |
sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 50 | 157 | 8.0E-08 |
sp|Q9J5G9|V034_FOWPN | Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 | 34 | 135 | 8.0E-08 |
sp|A1ZBY1|FEM1B_DROME | Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 | 52 | 158 | 8.0E-08 |
sp|Q9WV71|ASB4_MOUSE | Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 | 18 | 157 | 8.0E-08 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 9.0E-08 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 9.0E-08 |
sp|Q99PE2|ANRA2_MOUSE | Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 | 84 | 157 | 9.0E-08 |
sp|Q2KI79|ANRA2_BOVIN | Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 | 84 | 157 | 9.0E-08 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 52 | 162 | 9.0E-08 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 9 | 157 | 9.0E-08 |
sp|Q8IUH5|ZDH17_HUMAN | Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 | 15 | 154 | 9.0E-08 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 9 | 136 | 9.0E-08 |
sp|Q6P1S6|MTPN_XENTR | Myotrophin OS=Xenopus tropicalis GN=mtpn PE=3 SV=1 | 9 | 103 | 9.0E-08 |
sp|Q3SWY2|ILK_BOVIN | Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 | 4 | 150 | 9.0E-08 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 4 | 159 | 1.0E-07 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 46 | 145 | 1.0E-07 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 17 | 158 | 1.0E-07 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 9 | 138 | 1.0E-07 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 18 | 143 | 1.0E-07 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 31 | 161 | 1.0E-07 |
sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 54 | 148 | 1.0E-07 |
sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 20 | 157 | 1.0E-07 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 54 | 154 | 1.0E-07 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 5 | 126 | 1.0E-07 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 27 | 154 | 1.0E-07 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 5 | 126 | 1.0E-07 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 54 | 154 | 1.0E-07 |
sp|Q9H9E1|ANRA2_HUMAN | Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 | 84 | 157 | 1.0E-07 |
sp|Q29RM5|FEM1A_BOVIN | Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 | 15 | 157 | 1.0E-07 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 52 | 162 | 1.0E-07 |
sp|Q4P6L3|AKR1_USTMA | Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 | 1 | 147 | 1.0E-07 |
sp|Q5UR87|YR634_MIMIV | Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 | 9 | 144 | 1.0E-07 |
sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 15 | 141 | 1.0E-07 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 52 | 157 | 1.0E-07 |
sp|Q108U1|ASZ1_LOXAF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 | 18 | 103 | 1.0E-07 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 18 | 158 | 1.0E-07 |
sp|Q8IUH5|ZDH17_HUMAN | Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 | 35 | 158 | 1.0E-07 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 9 | 143 | 1.0E-07 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 6 | 163 | 1.0E-07 |
sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 16 | 101 | 1.0E-07 |
sp|Q4FE45|XB33_ARATH | E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 | 54 | 148 | 1.0E-07 |
sp|E9PTT0|ZDH17_RAT | Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 | 35 | 158 | 1.0E-07 |
sp|Q80TN5|ZDH17_MOUSE | Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 | 35 | 158 | 1.0E-07 |
sp|Q6TNT2|ANR46_DANRE | Ankyrin repeat domain-containing protein 46 OS=Danio rerio GN=ankrd46 PE=2 SV=1 | 85 | 158 | 1.0E-07 |
sp|Q1RJN6|Y347_RICBR | Putative ankyrin repeat protein RBE_0347 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0347 PE=3 SV=1 | 32 | 145 | 1.0E-07 |
sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 16 | 110 | 2.0E-07 |
sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 16 | 110 | 2.0E-07 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 66 | 157 | 2.0E-07 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 16 | 157 | 2.0E-07 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 17 | 158 | 2.0E-07 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 85 | 161 | 2.0E-07 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 85 | 161 | 2.0E-07 |
sp|Q5UQ08|YR787_MIMIV | Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 | 57 | 147 | 2.0E-07 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 57 | 161 | 2.0E-07 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 57 | 156 | 2.0E-07 |
sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 16 | 126 | 2.0E-07 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 57 | 157 | 2.0E-07 |
sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 54 | 154 | 2.0E-07 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 9 | 138 | 2.0E-07 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 54 | 154 | 2.0E-07 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 1 | 154 | 2.0E-07 |
sp|Q8GXE6|AKT6_ARATH | Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 | 40 | 143 | 2.0E-07 |
sp|Q9BSK4|FEM1A_HUMAN | Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 | 15 | 157 | 2.0E-07 |
sp|Q5UPH0|YL100_MIMIV | Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 | 16 | 146 | 2.0E-07 |
sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 3 | 156 | 2.0E-07 |
sp|Q8WXK4|ASB12_HUMAN | Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 | 16 | 144 | 2.0E-07 |
sp|Q6NLQ8|XB32_ARATH | E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 | 20 | 139 | 2.0E-07 |
sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 16 | 91 | 2.0E-07 |
sp|O54910|IKBE_MOUSE | NF-kappa-B inhibitor epsilon OS=Mus musculus GN=Nfkbie PE=1 SV=2 | 16 | 136 | 2.0E-07 |
sp|P0C7A6|BTBBB_DANRE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-B OS=Danio rerio GN=btbd11b PE=3 SV=1 | 84 | 159 | 2.0E-07 |
sp|Q94CT7|XB31_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 | 14 | 136 | 2.0E-07 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 53 | 157 | 2.0E-07 |
sp|Q337A0|XB33_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 | 54 | 148 | 2.0E-07 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 51 | 160 | 3.0E-07 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 9 | 136 | 3.0E-07 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 9 | 113 | 3.0E-07 |
sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 16 | 126 | 3.0E-07 |
sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 16 | 126 | 3.0E-07 |
sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 16 | 126 | 3.0E-07 |
sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 23 | 139 | 3.0E-07 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 9 | 128 | 3.0E-07 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 9 | 128 | 3.0E-07 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 54 | 154 | 3.0E-07 |
sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 42 | 141 | 3.0E-07 |
sp|Q0P5B9|ANR39_BOVIN | Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 | 54 | 154 | 3.0E-07 |
sp|Q99466|NOTC4_HUMAN | Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 | 9 | 154 | 3.0E-07 |
sp|Q5UPR3|YR777_MIMIV | Putative ankyrin repeat protein R777 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R777 PE=3 SV=1 | 11 | 143 | 3.0E-07 |
sp|E9PTT0|ZDH17_RAT | Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 | 15 | 154 | 3.0E-07 |
sp|Q80TN5|ZDH17_MOUSE | Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 | 15 | 154 | 3.0E-07 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 51 | 160 | 4.0E-07 |
sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 51 | 143 | 4.0E-07 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 9 | 142 | 4.0E-07 |
sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 16 | 117 | 4.0E-07 |
sp|Q5UPU4|YR267_MIMIV | Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 | 9 | 114 | 4.0E-07 |
sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 54 | 154 | 4.0E-07 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 9 | 155 | 4.0E-07 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 20 | 147 | 4.0E-07 |
sp|Q5UPR3|YR777_MIMIV | Putative ankyrin repeat protein R777 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R777 PE=3 SV=1 | 31 | 142 | 4.0E-07 |
sp|Q5ZLC6|ANR10_CHICK | Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 | 16 | 138 | 4.0E-07 |
sp|Q9Y576|ASB1_HUMAN | Ankyrin repeat and SOCS box protein 1 OS=Homo sapiens GN=ASB1 PE=1 SV=1 | 16 | 153 | 4.0E-07 |
sp|Q6DGX3|ANR54_DANRE | Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 | 16 | 91 | 4.0E-07 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 9 | 154 | 5.0E-07 |
sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 6 | 146 | 5.0E-07 |
sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 9 | 147 | 5.0E-07 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 27 | 154 | 5.0E-07 |
sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 13 | 137 | 5.0E-07 |
sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 17 | 124 | 5.0E-07 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 18 | 158 | 5.0E-07 |
sp|O88202|LPP60_RAT | 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 | 16 | 136 | 5.0E-07 |
sp|Q9WV74|ASB1_MOUSE | Ankyrin repeat and SOCS box protein 1 OS=Mus musculus GN=Asb1 PE=2 SV=1 | 12 | 154 | 5.0E-07 |
sp|Q337A0|XB33_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 | 20 | 137 | 5.0E-07 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 9 | 148 | 6.0E-07 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 32 | 160 | 6.0E-07 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 51 | 142 | 6.0E-07 |
sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 47 | 148 | 6.0E-07 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 18 | 143 | 6.0E-07 |
sp|Q9D2X0|ANR39_MOUSE | Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 | 54 | 142 | 6.0E-07 |
sp|Q53RE8|ANR39_HUMAN | Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 | 54 | 154 | 6.0E-07 |
sp|Q5UPH0|YL100_MIMIV | Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 | 52 | 147 | 6.0E-07 |
sp|Q5UQ04|YR791_MIMIV | Putative ankyrin repeat protein R791 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R791 PE=3 SV=1 | 20 | 155 | 6.0E-07 |
sp|Q5UPJ9|YL122_MIMIV | Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 | 66 | 161 | 6.0E-07 |
sp|Q5UPE2|YL063_MIMIV | Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 | 13 | 115 | 7.0E-07 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 15 | 154 | 7.0E-07 |
sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 16 | 158 | 7.0E-07 |
sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 51 | 157 | 7.0E-07 |
sp|Q9J5A7|V155_FOWPN | Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 | 15 | 146 | 7.0E-07 |
sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 17 | 121 | 7.0E-07 |
sp|Q09YN0|ASZ1_RABIT | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 | 18 | 103 | 7.0E-07 |
sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 15 | 162 | 7.0E-07 |
sp|A1X154|ASZ1_ECHTE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 | 18 | 103 | 7.0E-07 |
sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 2 | 145 | 7.0E-07 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 16 | 154 | 7.0E-07 |
sp|Q9HLN1|Y196_THEAC | Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 | 9 | 136 | 7.0E-07 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 9 | 158 | 8.0E-07 |
sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 9 | 106 | 8.0E-07 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 15 | 141 | 8.0E-07 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 50 | 159 | 8.0E-07 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 9 | 133 | 8.0E-07 |
sp|P39010|AKR1_YEAST | Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 | 29 | 154 | 8.0E-07 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 16 | 157 | 8.0E-07 |
sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 54 | 154 | 8.0E-07 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 51 | 160 | 9.0E-07 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 4 | 143 | 9.0E-07 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 8 | 156 | 9.0E-07 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 8 | 156 | 9.0E-07 |
sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 31 | 158 | 9.0E-07 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 9.0E-07 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 9 | 133 | 9.0E-07 |
sp|P77736|YAHD_ECOLI | Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 | 16 | 108 | 9.0E-07 |
sp|P07207|NOTCH_DROME | Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 | 9 | 160 | 9.0E-07 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 16 | 149 | 9.0E-07 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 9 | 76 | 1.0E-06 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 9 | 92 | 1.0E-06 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 84 | 157 | 1.0E-06 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 9 | 113 | 1.0E-06 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 54 | 157 | 1.0E-06 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 9 | 139 | 1.0E-06 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 9 | 139 | 1.0E-06 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 54 | 157 | 1.0E-06 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 8 | 156 | 1.0E-06 |
sp|Q5UQZ7|YR901_MIMIV | Putative ankyrin repeat protein R901 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R901 PE=3 SV=1 | 17 | 114 | 1.0E-06 |
sp|Q5UQF1|YL483_MIMIV | Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 | 31 | 144 | 1.0E-06 |
sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 9 | 143 | 1.0E-06 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 9 | 141 | 1.0E-06 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 23 | 147 | 1.0E-06 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 16 | 159 | 1.0E-06 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 16 | 159 | 1.0E-06 |
sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 23 | 141 | 1.0E-06 |
sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 54 | 157 | 1.0E-06 |
sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 23 | 141 | 1.0E-06 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 1 | 159 | 1.0E-06 |
sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 17 | 105 | 1.0E-06 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 6 | 104 | 1.0E-06 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 6 | 104 | 1.0E-06 |
sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 10 | 163 | 1.0E-06 |
sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 43 | 141 | 1.0E-06 |
sp|Q6NLQ8|XB32_ARATH | E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 | 9 | 157 | 1.0E-06 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 12 | 154 | 1.0E-06 |
sp|P40480|HOS4_YEAST | Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 | 9 | 75 | 1.0E-06 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 9 | 143 | 1.0E-06 |
sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 11 | 158 | 1.0E-06 |
sp|Q8K3X6|ANS4B_MOUSE | Ankyrin repeat and SAM domain-containing protein 4B OS=Mus musculus GN=Anks4b PE=1 SV=1 | 5 | 103 | 1.0E-06 |
sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 11 | 158 | 1.0E-06 |
sp|A0PJZ0|A20A5_HUMAN | Putative ankyrin repeat domain-containing protein 20A5 OS=Homo sapiens GN=ANKRD20A5P PE=5 SV=1 | 33 | 145 | 1.0E-06 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 9 | 143 | 2.0E-06 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 51 | 160 | 2.0E-06 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 54 | 157 | 2.0E-06 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 54 | 157 | 2.0E-06 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 66 | 157 | 2.0E-06 |
sp|Q5UP11|YR848_MIMIV | Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 | 15 | 112 | 2.0E-06 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 57 | 156 | 2.0E-06 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 48 | 157 | 2.0E-06 |
sp|Q8H569|AKT3_ORYSJ | Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 | 88 | 154 | 2.0E-06 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 18 | 124 | 2.0E-06 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 18 | 124 | 2.0E-06 |
sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 23 | 141 | 2.0E-06 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 6 | 104 | 2.0E-06 |
sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 5 | 114 | 2.0E-06 |
sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 84 | 161 | 2.0E-06 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 9 | 138 | 2.0E-06 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 54 | 154 | 2.0E-06 |
sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 22 | 157 | 2.0E-06 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 9 | 158 | 2.0E-06 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 16 | 157 | 2.0E-06 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 16 | 158 | 2.0E-06 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 54 | 154 | 2.0E-06 |
sp|Q9SM23|ACBP1_ARATH | Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 | 21 | 124 | 2.0E-06 |
sp|Q9J4Z8|V242_FOWPN | Putative ankyrin repeat protein FPV242 OS=Fowlpox virus (strain NVSL) GN=FPV242 PE=3 SV=1 | 16 | 109 | 2.0E-06 |
sp|Q9Y576|ASB1_HUMAN | Ankyrin repeat and SOCS box protein 1 OS=Homo sapiens GN=ASB1 PE=1 SV=1 | 18 | 115 | 2.0E-06 |
sp|Q9Y576|ASB1_HUMAN | Ankyrin repeat and SOCS box protein 1 OS=Homo sapiens GN=ASB1 PE=1 SV=1 | 14 | 154 | 2.0E-06 |
sp|Q07DZ7|ASZ1_ORNAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 | 10 | 103 | 2.0E-06 |
sp|Q9J503|V232_FOWPN | Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 | 12 | 125 | 2.0E-06 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 15 | 158 | 2.0E-06 |
sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 11 | 159 | 2.0E-06 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 6 | 147 | 2.0E-06 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 31 | 137 | 3.0E-06 |
sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 9 | 121 | 3.0E-06 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 17 | 155 | 3.0E-06 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 16 | 155 | 3.0E-06 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 3.0E-06 |
sp|Q6NSI1|AR26L_HUMAN | Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 | 50 | 142 | 3.0E-06 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 20 | 143 | 3.0E-06 |
sp|Q108T9|CTTB2_LOXAF | Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 3.0E-06 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 9 | 138 | 3.0E-06 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 3.0E-06 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 14 | 157 | 3.0E-06 |
sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 47 | 141 | 3.0E-06 |
sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 47 | 141 | 3.0E-06 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 3.0E-06 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 23 | 157 | 3.0E-06 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 3.0E-06 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 9 | 143 | 3.0E-06 |
sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 19 | 157 | 3.0E-06 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 69 | 157 | 3.0E-06 |
sp|A2RUV0|NOTC1_XENTR | Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis GN=notch1 PE=1 SV=2 | 9 | 145 | 3.0E-06 |
sp|Q9R172|NOTC3_RAT | Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 | 15 | 139 | 3.0E-06 |
sp|Q9UM47|NOTC3_HUMAN | Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 | 15 | 139 | 3.0E-06 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 9 | 136 | 4.0E-06 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 68 | 157 | 4.0E-06 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 9 | 136 | 4.0E-06 |
sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 88 | 154 | 4.0E-06 |
sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 88 | 154 | 4.0E-06 |
sp|A1X157|CTTB2_ECHTE | Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 4.0E-06 |
sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 9 | 157 | 4.0E-06 |
sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 20 | 154 | 4.0E-06 |
sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 69 | 162 | 4.0E-06 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 16 | 150 | 4.0E-06 |
sp|Q61982|NOTC3_MOUSE | Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 | 15 | 139 | 4.0E-06 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 31 | 138 | 5.0E-06 |
sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 51 | 143 | 5.0E-06 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 5.0E-06 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 5.0E-06 |
sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 15 | 146 | 5.0E-06 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 5.0E-06 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 5.0E-06 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 5.0E-06 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 54 | 157 | 5.0E-06 |
sp|Q9HYV6|Y3287_PSEAE | Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 | 16 | 136 | 5.0E-06 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 31 | 137 | 6.0E-06 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 4 | 114 | 6.0E-06 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 9 | 136 | 6.0E-06 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 8 | 156 | 6.0E-06 |
sp|Q5UQY4|YR886_MIMIV | Putative ankyrin repeat protein R886 (Fragment) OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R886 PE=4 SV=1 | 16 | 75 | 6.0E-06 |
sp|Q2QLB3|CTTB2_CALMO | Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 6.0E-06 |
sp|Q07DV1|CTTB2_AOTNA | Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 6.0E-06 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 6.0E-06 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 52 | 157 | 6.0E-06 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 6.0E-06 |
sp|Q80T11|USH1G_MOUSE | Usher syndrome type-1G protein homolog OS=Mus musculus GN=Ush1g PE=1 SV=1 | 57 | 161 | 6.0E-06 |
sp|Q6GQW0|BTBDB_MOUSE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 OS=Mus musculus GN=Btbd11 PE=2 SV=2 | 84 | 160 | 6.0E-06 |
sp|Q94CT7|XB31_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 | 79 | 143 | 6.0E-06 |
sp|Q01317|NUC2_NEUCR | Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 | 16 | 144 | 6.0E-06 |
sp|Q6UB99|ANR11_HUMAN | Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 | 52 | 159 | 6.0E-06 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 31 | 137 | 7.0E-06 |
sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 84 | 147 | 7.0E-06 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 69 | 159 | 7.0E-06 |
sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 51 | 160 | 7.0E-06 |
sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 18 | 125 | 7.0E-06 |
sp|Q9SCX5|AKT5_ARATH | Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 | 40 | 144 | 7.0E-06 |
sp|Q495M9|USH1G_HUMAN | Usher syndrome type-1G protein OS=Homo sapiens GN=USH1G PE=1 SV=1 | 57 | 161 | 7.0E-06 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 54 | 157 | 7.0E-06 |
sp|Q8N8V4|ANS4B_HUMAN | Ankyrin repeat and SAM domain-containing protein 4B OS=Homo sapiens GN=ANKS4B PE=1 SV=2 | 5 | 103 | 7.0E-06 |
sp|Q86U10|LPP60_HUMAN | 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 | 15 | 136 | 7.0E-06 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 55 | 157 | 8.0E-06 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 14 | 124 | 8.0E-06 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 52 | 157 | 8.0E-06 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 8.0E-06 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 52 | 157 | 8.0E-06 |
sp|A0PJZ0|A20A5_HUMAN | Putative ankyrin repeat domain-containing protein 20A5 OS=Homo sapiens GN=ANKRD20A5P PE=5 SV=1 | 48 | 154 | 8.0E-06 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 84 | 157 | 9.0E-06 |
sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 9 | 106 | 9.0E-06 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 31 | 138 | 9.0E-06 |
sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 52 | 157 | 9.0E-06 |
sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 9 | 157 | 9.0E-06 |
sp|A6QL63|BTBDB_HUMAN | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 OS=Homo sapiens GN=BTBD11 PE=2 SV=3 | 84 | 160 | 9.0E-06 |
sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 54 | 157 | 9.0E-06 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 20 | 157 | 9.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005515 | protein binding | Yes |
GO:0005488 | binding | No |
GO:0003674 | molecular_function | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 45 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauG2|2930 MASKTETWINQTGPDGRTALSYAAENGHEAILKLLLERGADTEAQGIYSHRTPLFYAAENGHEAILKLLLERGAD TEAKDTIFGKTPLSYAAENGHEAILKLLLERGADIESKDYREQTPLLLAVARGQEAIVKYLLEQGADIEAKEYED QTPLLLAGAMKLS* |
Coding | >OphauG2|2930 ATGGCAAGTAAGACCGAGACGTGGATCAACCAAACGGGCCCGGACGGCCGGACGGCGCTTTCTTACGCAGCCGAG AACGGCCACGAAGCTATCCTGAAGCTATTACTCGAGAGGGGCGCCGATACCGAGGCTCAAGGCATCTACTCTCAC CGGACACCGCTTTTTTACGCAGCCGAGAACGGCCACGAAGCTATCCTGAAGCTATTACTCGAGAGGGGCGCCGAT ACCGAGGCTAAAGACACCATCTTTGGCAAGACACCGCTTTCTTACGCAGCCGAGAACGGCCACGAAGCTATCCTC AAGTTATTACTCGAGAGGGGCGCCGATATCGAGTCTAAAGATTATCGTGAACAGACACCGCTTCTATTAGCAGTC GCAAGGGGCCAAGAAGCTATTGTGAAGTATTTGCTCGAACAGGGCGCCGATATCGAAGCCAAAGAGTATGAAGAT CAGACGCCGCTTCTATTGGCAGGGGCCATGAAGCTATCGTGA |
Transcript | >OphauG2|2930 ATGGCAAGTAAGACCGAGACGTGGATCAACCAAACGGGCCCGGACGGCCGGACGGCGCTTTCTTACGCAGCCGAG AACGGCCACGAAGCTATCCTGAAGCTATTACTCGAGAGGGGCGCCGATACCGAGGCTCAAGGCATCTACTCTCAC CGGACACCGCTTTTTTACGCAGCCGAGAACGGCCACGAAGCTATCCTGAAGCTATTACTCGAGAGGGGCGCCGAT ACCGAGGCTAAAGACACCATCTTTGGCAAGACACCGCTTTCTTACGCAGCCGAGAACGGCCACGAAGCTATCCTC AAGTTATTACTCGAGAGGGGCGCCGATATCGAGTCTAAAGATTATCGTGAACAGACACCGCTTCTATTAGCAGTC GCAAGGGGCCAAGAAGCTATTGTGAAGTATTTGCTCGAACAGGGCGCCGATATCGAAGCCAAAGAGTATGAAGAT CAGACGCCGCTTCTATTGGCAGGGGCCATGAAGCTATCGTGA |
Gene | >OphauG2|2930 ATGGCAAGTAAGACCGAGACGTGGATCAACCAAACGGGCCCGGACGGCCGGACGGCGCTTTCTTACGCAGCCGAG AACGGCCACGAAGCTATCCTGAAGCTATTACTCGAGAGGGGCGCCGATACCGAGGCTCAAGGCATCTACTCTCAC CGGACACCGCTTTTTTACGCAGCCGAGAACGGCCACGAAGCTATCCTGAAGCTATTACTCGAGAGGGGCGCCGAT ACCGAGGCTAAAGACACCATCTTTGGCAAGACACCGCTTTCTTACGCAGCCGAGAACGGCCACGAAGCTATCCTC AAGTTATTACTCGAGAGGGGCGCCGATATCGAGTCTAAAGATTATCGTGAACAGACACCGCTTCTATTAGCAGTC GCAAGGGGCCAAGAAGCTATTGTGAAGTATTTGCTCGAACAGGGCGCCGATATCGAAGCCAAAGAGTATGAAGAT CAGACGCCGCTTCTATTGGCAGTTCAGAAGGGGCACTACACTATCATGATGCAATTACTTGATAAGGGCGCCGAT ATCGAAGCCAAAGATAATTATGGCTGGACACCATTAATATGGGCAGCCACAGGGGGCCATGAAGCTATCGTGA |