Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|293
Gene name
LocationContig_1062:2256..3105
Strand-
Gene length (bp)849
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 3.2E-10 44 125
PF13847 Methyltransf_31 Methyltransferase domain 1.7E-07 40 98
PF08241 Methyltransf_11 Methyltransferase domain 5.3E-06 45 86
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.5E-05 39 99

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1039
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|293 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|7061
Ophiocordyceps australis map64 (Brazil) OphauB2|316
Ophiocordyceps australis map64 (Brazil) OphauB2|4755
Ophiocordyceps subramaniannii Hirsu2|9619
Ophiocordyceps subramaniannii Hirsu2|9620

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|293
MAETPEYDAIGSAYNVIETLPHRSMEFYNVDMAIKPFLRPGMHVLDMACGTGTYTGRLLSLGASSVTGVDISKVM
LENAKTRLSTCLDAGKVRLFRGDGGVPQSWAPNGTTNYFNLAFGGWFLNYASSRTELTLFFKTIASNLDSCGVFV
GIVFSPVDNDDEMRRRKMDYKCEPICRLYPRYTCMAPVPSGDGWKVDVKLSESVGFSTWHLYRHIYEEAARDGGM
LGAFEWRHEKLLNLDQWAKHFGLSLDEVKLRQQVPHIGVVVVRKNGNGKEADAASKI*
Coding >OphauG2|293
ATGGCCGAGACTCCAGAGTACGATGCAATTGGAAGCGCATACAACGTAATAGAGACTTTGCCTCATCGATCCATG
GAATTCTACAACGTGGACATGGCAATAAAGCCATTTTTACGGCCGGGCATGCATGTCCTCGACATGGCGTGCGGC
ACCGGCACCTACACTGGCCGATTGCTAAGCCTCGGTGCTAGCAGCGTAACAGGCGTGGACATATCAAAAGTCATG
TTAGAGAATGCCAAAACTCGGCTATCAACATGCCTCGATGCTGGAAAAGTCCGACTCTTTCGGGGAGATGGCGGC
GTGCCGCAATCATGGGCGCCCAATGGCACGACAAACTATTTCAACTTGGCCTTTGGAGGATGGTTTCTCAACTAC
GCCAGCTCCCGCACCGAGCTCACTTTGTTTTTCAAAACCATTGCCAGCAACTTGGACTCGTGTGGAGTCTTTGTC
GGTATTGTTTTTAGTCCTGTGGACAATGATGACGAGATGCGGCGTAGGAAAATGGATTACAAGTGTGAGCCAATA
TGCCGACTATATCCGCGGTATACCTGCATGGCACCGGTGCCCTCTGGAGATGGTTGGAAGGTGGATGTCAAACTA
AGCGAGAGCGTGGGCTTCTCGACCTGGCATCTCTATCGCCACATCTATGAAGAAGCGGCTCGAGATGGCGGCATG
CTGGGAGCCTTTGAATGGCGACACGAGAAGCTCCTGAATCTAGATCAATGGGCCAAGCATTTCGGACTAAGCTTG
GATGAGGTCAAGTTGCGCCAACAGGTGCCACACATTGGTGTAGTTGTGGTTCGAAAAAACGGCAATGGAAAAGAG
GCCGATGCTGCATCTAAAATTTGA
Transcript >OphauG2|293
ATGGCCGAGACTCCAGAGTACGATGCAATTGGAAGCGCATACAACGTAATAGAGACTTTGCCTCATCGATCCATG
GAATTCTACAACGTGGACATGGCAATAAAGCCATTTTTACGGCCGGGCATGCATGTCCTCGACATGGCGTGCGGC
ACCGGCACCTACACTGGCCGATTGCTAAGCCTCGGTGCTAGCAGCGTAACAGGCGTGGACATATCAAAAGTCATG
TTAGAGAATGCCAAAACTCGGCTATCAACATGCCTCGATGCTGGAAAAGTCCGACTCTTTCGGGGAGATGGCGGC
GTGCCGCAATCATGGGCGCCCAATGGCACGACAAACTATTTCAACTTGGCCTTTGGAGGATGGTTTCTCAACTAC
GCCAGCTCCCGCACCGAGCTCACTTTGTTTTTCAAAACCATTGCCAGCAACTTGGACTCGTGTGGAGTCTTTGTC
GGTATTGTTTTTAGTCCTGTGGACAATGATGACGAGATGCGGCGTAGGAAAATGGATTACAAGTGTGAGCCAATA
TGCCGACTATATCCGCGGTATACCTGCATGGCACCGGTGCCCTCTGGAGATGGTTGGAAGGTGGATGTCAAACTA
AGCGAGAGCGTGGGCTTCTCGACCTGGCATCTCTATCGCCACATCTATGAAGAAGCGGCTCGAGATGGCGGCATG
CTGGGAGCCTTTGAATGGCGACACGAGAAGCTCCTGAATCTAGATCAATGGGCCAAGCATTTCGGACTAAGCTTG
GATGAGGTCAAGTTGCGCCAACAGGTGCCACACATTGGTGTAGTTGTGGTTCGAAAAAACGGCAATGGAAAAGAG
GCCGATGCTGCATCTAAAATTTGA
Gene >OphauG2|293
ATGGCCGAGACTCCAGAGTACGATGCAATTGGAAGCGCATACAACGTAATAGAGACTTTGCCTCATCGATCCATG
GAATTCTACAACGTGGACATGGCAATAAAGCCATTTTTACGGCCGGGCATGCATGTCCTCGACATGGCGTGCGGC
ACCGGCACCTACACTGGCCGATTGCTAAGCCTCGGTGCTAGCAGCGTAACAGGCGTGGACATATCAAAAGTCATG
TTAGAGAATGCCAAAACTCGGCTATCAACATGCCTCGATGCTGGAAAAGTCCGACTCTTTCGGGGAGATGGCGGC
GTGCCGCAATCATGGGCGCCCAATGGCACGACAAACTATTTCAACTTGGCCTTTGGAGGATGGTTTCTCAACTAC
GCCAGCTCCCGCACCGAGCTCACTTTGTTTTTCAAAACCATTGCCAGCAACTTGGACTCGTGTGGAGTCTTTGTC
GGTATTGTTTTTAGTCCTGTGGACAATGATGACGAGATGCGGCGTAGGAAAATGGATTACAAGTGTGAGCCAATA
TGCCGACTATATCCGCGGTATACCTGCATGGCACCGGTGCCCTCTGGAGATGGTTGGAAGGTGGATGTCAAACTA
AGCGAGAGCGTGGGCTTCTCGACCTGGCATCTCTATCGCCACATCTATGAAGAAGCGGCTCGAGATGGCGGCATG
CTGGGAGCCTTTGAATGGCGACACGAGAAGCTCCTGAATCTAGATCAATGGGCCAAGCATTTCGGACTAAGCTTG
GATGAGGTCAAGTTGCGCCAACAGGTGCCACACATTGGTGTAGTTGTGGTTCGAAAAAACGGCAATGGAAAAGAG
GCCGATGCTGCATCTAAAATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail