Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2922
Gene name
LocationContig_214:9416..10474
Strand-
Gene length (bp)1058
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05670 NFACT-R_1 NFACT protein RNA binding domain 8.1E-34 1 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T312|CCD25_DANRE Coiled-coil domain-containing protein 25 OS=Danio rerio GN=ccdc25 PE=1 SV=1 1 223 4.0E-54
sp|Q78PG9|CCD25_MOUSE Coiled-coil domain-containing protein 25 OS=Mus musculus GN=Ccdc25 PE=1 SV=1 1 165 2.0E-51
sp|Q6GLE1|CCD25_XENTR Coiled-coil domain-containing protein 25 OS=Xenopus tropicalis GN=ccdc25 PE=2 SV=1 1 223 6.0E-51
sp|Q5R9S1|CCD25_PONAB Coiled-coil domain-containing protein 25 OS=Pongo abelii GN=CCDC25 PE=2 SV=2 1 168 8.0E-51
sp|Q86WR0|CCD25_HUMAN Coiled-coil domain-containing protein 25 OS=Homo sapiens GN=CCDC25 PE=1 SV=2 1 168 8.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7T312|CCD25_DANRE Coiled-coil domain-containing protein 25 OS=Danio rerio GN=ccdc25 PE=1 SV=1 1 223 4.0E-54
sp|Q78PG9|CCD25_MOUSE Coiled-coil domain-containing protein 25 OS=Mus musculus GN=Ccdc25 PE=1 SV=1 1 165 2.0E-51
sp|Q6GLE1|CCD25_XENTR Coiled-coil domain-containing protein 25 OS=Xenopus tropicalis GN=ccdc25 PE=2 SV=1 1 223 6.0E-51
sp|Q5R9S1|CCD25_PONAB Coiled-coil domain-containing protein 25 OS=Pongo abelii GN=CCDC25 PE=2 SV=2 1 168 8.0E-51
sp|Q86WR0|CCD25_HUMAN Coiled-coil domain-containing protein 25 OS=Homo sapiens GN=CCDC25 PE=1 SV=2 1 168 8.0E-51
sp|Q3SZX8|CCD25_BOVIN Coiled-coil domain-containing protein 25 OS=Bos taurus GN=CCDC25 PE=2 SV=1 1 160 8.0E-51
sp|Q55D55|CCD25_DICDI Coiled-coil domain-containing protein 25 homolog OS=Dictyostelium discoideum GN=ccdc25 PE=3 SV=1 1 223 2.0E-46
sp|P40206|JLP2_YEAST Protein JLP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JLP2 PE=1 SV=2 1 148 7.0E-27
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2922
MVYYFSSTVVDPAAVIYVGKDKFENEDLIKFGWDQDVCHIPHLVPCYRFHVDKLSSAHVYLRMQEGQAWDALPND
LVEDLAQLTKANSIEGNKKDNITVIYTPWSNLKKDGRMDVGQVSFKDARLVKRILVPQRVNAIVNRLNKTKVEKK
PDFRQERDDHLKELRKRENLAQEQRKREEAKQAQEWQQKKWQKDHAYDDMFTEENMLASSNQTRQEDWEDDFM*
Coding >OphauG2|2922
ATGGTCTACTACTTCTCCTCGACCGTCGTCGACCCTGCAGCCGTCATCTATGTCGGCAAAGACAAGTTTGAGAAC
GAAGATCTCATCAAATTTGGCTGGGACCAAGATGTCTGTCACATTCCTCATCTTGTTCCCTGCTATAGGTTTCAC
GTCGACAAGCTTTCCAGTGCTCATGTCTATCTCCGAATGCAAGAGGGCCAGGCTTGGGACGCGCTGCCCAATGAC
CTTGTTGAGGATCTTGCCCAGTTGACAAAGGCAAACTCTATAGAGGGGAACAAAAAGGATAACATTACCGTCATT
TACACACCTTGGTCAAATCTCAAAAAGGATGGGCGCATGGACGTGGGCCAAGTGAGCTTTAAGGATGCCCGACTG
GTGAAGCGCATCTTGGTGCCCCAACGCGTCAATGCCATTGTCAACCGTCTTAACAAGACAAAGGTTGAGAAGAAG
CCCGACTTTAGACAGGAGCGAGATGATCACCTCAAGGAGCTGCGTAAAAGAGAAAATCTCGCCCAAGAACAACGA
AAGAGGGAAGAGGCCAAACAGGCACAAGAGTGGCAACAGAAAAAGTGGCAAAAGGACCACGCATATGACGACATG
TTTACTGAAGAGAACATGCTTGCCTCTAGCAACCAAACCCGGCAAGAAGATTGGGAGGACGACTTTATGTAG
Transcript >OphauG2|2922
ATGGTCTACTACTTCTCCTCGACCGTCGTCGACCCTGCAGCCGTCATCTATGTCGGCAAAGACAAGTTTGAGAAC
GAAGATCTCATCAAATTTGGCTGGGACCAAGATGTCTGTCACATTCCTCATCTTGTTCCCTGCTATAGGTTTCAC
GTCGACAAGCTTTCCAGTGCTCATGTCTATCTCCGAATGCAAGAGGGCCAGGCTTGGGACGCGCTGCCCAATGAC
CTTGTTGAGGATCTTGCCCAGTTGACAAAGGCAAACTCTATAGAGGGGAACAAAAAGGATAACATTACCGTCATT
TACACACCTTGGTCAAATCTCAAAAAGGATGGGCGCATGGACGTGGGCCAAGTGAGCTTTAAGGATGCCCGACTG
GTGAAGCGCATCTTGGTGCCCCAACGCGTCAATGCCATTGTCAACCGTCTTAACAAGACAAAGGTTGAGAAGAAG
CCCGACTTTAGACAGGAGCGAGATGATCACCTCAAGGAGCTGCGTAAAAGAGAAAATCTCGCCCAAGAACAACGA
AAGAGGGAAGAGGCCAAACAGGCACAAGAGTGGCAACAGAAAAAGTGGCAAAAGGACCACGCATATGACGACATG
TTTACTGAAGAGAACATGCTTGCCTCTAGCAACCAAACCCGGCAAGAAGATTGGGAGGACGACTTTATGTAG
Gene >OphauG2|2922
ATGGTCTACTACTTCTCCTCGACCGTCGTCGACCCTGCAGCCGTCATCTATGTCGGCAAAGACAAGTTTGAGAGT
AGGTCCACGGCAGACGGCCCCATGTGCATGCCAGAGCAATGCGCAGTAGCCTGTCTTTTCTCACATTGACTAGAC
GAAGATCTCATCAAATTTGGCTGGGACCAAGATGTCTGGTAAGCACAGCTTCCAGCCCCTTCAGCCCAGAAGTGC
GCCAAGTCACATTCCTCATCTTGTTCCCTGCTATAGGGTAAGCCTCTTGCTGCCTGCGCATGCAAGCATCATGCT
CTTTTGACATGGCAATAGTTTCACGTCGACAAGCTTTCCAGTGCTCATGTCTATCTCCGAATGCAAGAGGGCCAG
GCTTGGGACGCGCTGCCCAATGACCTTGTTGAGGATCTTGCCCAGTTGACAAAGGCAAACTCTATAGAGGGTACT
TTGTTTCTCAGCTCGCCCTCGAGCCAGCACTCTCTCTCTCTCCCGCTCCAGGCTGACTCGAGCAGGGAACAAAAA
GGATAACATTACCGTCATTTACACACCTTGGTCAAATCTCAAAAAGGATGGGCGCATGGACGTGGGCCAAGTGAG
CTTTAAGGATGCCCGACTGGTGAGTCTTTTTTTTTTTCCTTTTTGGTCCAATATTGCTACGCCATGCGCGCAGAC
TGATGATTCAGGTGTAGGTGAAGCGCATCTTGGTGCCCCAACGCGTCAATGCCATTGTCAACCGTCTTAACAAGA
CAAAGGTTGAGAAGAAGCCCGACTTTAGACAGGAGCGAGATGATCACCTCAAGGAGCTGCGTAAAAGAGAAAATC
TCGCCCAAGAACAACGAGTCTGTAGATTCCATGTTTTTTTTCTTATCCTTCTTTTGAATGGTGTGCGCGATATTA
ACACGTCACAGAAGAGGGAAGAGGCCAAACAGGCACAAGAGTGGCAACAGAAAAAGTGGCAAAAGGACCACGCAT
ATGACGACATGTTTACTGAAGAGAACATGCTTGCCTCTAGCAACCAAACCCGGCAAGAAGATTGGGAGGACGACT
TTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail