Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2919
Gene name
LocationContig_2136:535..1234
Strand-
Gene length (bp)699
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16679 CDT1_C DNA replication factor Cdt1 C-terminal domain 2.8E-22 106 203

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6446
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2919 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7729
Ophiocordyceps camponoti-floridani Ophcf2|00956
Ophiocordyceps camponoti-rufipedis Ophun1|7128
Ophiocordyceps kimflemingae Ophio5|1040

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2919
MRHSPADLDRLSSQFVDNLHHLASQRPASPDTMDIDHVSLGRLSLSDLPQAAVEDKTPCSANNPLLAKGQRALAH
LKSGLPAKQDQQQQQQQQPHATANSQLSKLSLLDRIRLKQDARNAATPPTAAELMHKAALDRVVDVAATLSMLSL
ASGQLPRQAFAMGLVVQRLRDSLQLPISKDEGAACVRLIAGQVAPEWIRVVTLGGRENVVICKAGQPADRVLRGR
VDELMTA*
Coding >OphauG2|2919
ATGCGCCACTCGCCTGCCGACTTGGACCGGCTCAGTAGCCAGTTTGTCGACAACTTGCATCATCTTGCCTCGCAG
CGGCCCGCGAGCCCCGACACAATGGACATTGACCATGTGTCTCTTGGCCGTCTGTCCCTGTCAGATCTTCCGCAA
GCGGCCGTTGAGGACAAGACTCCATGCAGTGCCAACAATCCCCTCCTAGCCAAAGGGCAACGGGCTCTCGCGCAC
CTCAAGAGCGGCTTGCCAGCCAAACAAGACCAGCAGCAGCAGCAACAACAACAGCCTCACGCCACGGCCAATTCC
CAGCTCTCCAAACTCAGTCTTCTTGATCGCATCCGGCTCAAGCAGGACGCTCGCAACGCCGCCACGCCTCCCACT
GCCGCCGAGCTGATGCACAAGGCCGCTCTAGACCGGGTCGTTGACGTGGCAGCAACACTGTCAATGCTGAGCTTG
GCGAGCGGCCAGCTGCCTCGGCAGGCCTTTGCCATGGGCTTAGTGGTGCAGCGGCTGCGCGACTCGTTGCAGCTG
CCCATTTCCAAGGACGAGGGCGCAGCTTGCGTGCGGCTGATTGCGGGCCAGGTGGCGCCCGAGTGGATTCGCGTG
GTGACGCTGGGCGGCCGTGAAAATGTCGTCATTTGCAAGGCTGGGCAGCCGGCGGACAGGGTCTTGCGTGGGCGG
GTGGATGAATTGATGACGGCATAG
Transcript >OphauG2|2919
ATGCGCCACTCGCCTGCCGACTTGGACCGGCTCAGTAGCCAGTTTGTCGACAACTTGCATCATCTTGCCTCGCAG
CGGCCCGCGAGCCCCGACACAATGGACATTGACCATGTGTCTCTTGGCCGTCTGTCCCTGTCAGATCTTCCGCAA
GCGGCCGTTGAGGACAAGACTCCATGCAGTGCCAACAATCCCCTCCTAGCCAAAGGGCAACGGGCTCTCGCGCAC
CTCAAGAGCGGCTTGCCAGCCAAACAAGACCAGCAGCAGCAGCAACAACAACAGCCTCACGCCACGGCCAATTCC
CAGCTCTCCAAACTCAGTCTTCTTGATCGCATCCGGCTCAAGCAGGACGCTCGCAACGCCGCCACGCCTCCCACT
GCCGCCGAGCTGATGCACAAGGCCGCTCTAGACCGGGTCGTTGACGTGGCAGCAACACTGTCAATGCTGAGCTTG
GCGAGCGGCCAGCTGCCTCGGCAGGCCTTTGCCATGGGCTTAGTGGTGCAGCGGCTGCGCGACTCGTTGCAGCTG
CCCATTTCCAAGGACGAGGGCGCAGCTTGCGTGCGGCTGATTGCGGGCCAGGTGGCGCCCGAGTGGATTCGCGTG
GTGACGCTGGGCGGCCGTGAAAATGTCGTCATTTGCAAGGCTGGGCAGCCGGCGGACAGGGTCTTGCGTGGGCGG
GTGGATGAATTGATGACGGCATAG
Gene >OphauG2|2919
ATGCGCCACTCGCCTGCCGACTTGGACCGGCTCAGTAGCCAGTTTGTCGACAACTTGCATCATCTTGCCTCGCAG
CGGCCCGCGAGCCCCGACACAATGGACATTGACCATGTGTCTCTTGGCCGTCTGTCCCTGTCAGATCTTCCGCAA
GCGGCCGTTGAGGACAAGACTCCATGCAGTGCCAACAATCCCCTCCTAGCCAAAGGGCAACGGGCTCTCGCGCAC
CTCAAGAGCGGCTTGCCAGCCAAACAAGACCAGCAGCAGCAGCAACAACAACAGCCTCACGCCACGGCCAATTCC
CAGCTCTCCAAACTCAGTCTTCTTGATCGCATCCGGCTCAAGCAGGACGCTCGCAACGCCGCCACGCCTCCCACT
GCCGCCGAGCTGATGCACAAGGCCGCTCTAGACCGGGTCGTTGACGTGGCAGCAACACTGTCAATGCTGAGCTTG
GCGAGCGGCCAGCTGCCTCGGCAGGCCTTTGCCATGGGCTTAGTGGTGCAGCGGCTGCGCGACTCGTTGCAGCTG
CCCATTTCCAAGGACGAGGGCGCAGCTTGCGTGCGGCTGATTGCGGGCCAGGTGGCGCCCGAGTGGATTCGCGTG
GTGACGCTGGGCGGCCGTGAAAATGTCGTCATTTGCAAGGCTGGGCAGCCGGCGGACAGGGTCTTGCGTGGGCGG
GTGGATGAATTGATGACGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail