Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2912
Gene name
LocationContig_213:10260..11508
Strand+
Gene length (bp)1248
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 3.7E-04 35 152
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 5.7E-14 223 368

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96X22|HPPD_MAGO7 4-hydroxyphenylpyruvate dioxygenase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HPD4 PE=3 SV=1 1 415 0.0E+00
sp|Q872T7|HPPD_NEUCR 4-hydroxyphenylpyruvate dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23G1.170 PE=3 SV=1 1 415 0.0E+00
sp|O42764|HPPD_ZYMTR 4-hydroxyphenylpyruvate dioxygenase OS=Zymoseptoria tritici GN=HPPD PE=3 SV=1 26 415 5.0E-177
sp|Q4WHU1|HPPD1_ASPFU Probable 4-hydroxyphenylpyruvate dioxygenase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G04200 PE=3 SV=1 1 415 8.0E-172
sp|Q6CDR5|HPPD_YARLI 4-hydroxyphenylpyruvate dioxygenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B21846g PE=3 SV=1 31 415 5.0E-167
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96X22|HPPD_MAGO7 4-hydroxyphenylpyruvate dioxygenase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HPD4 PE=3 SV=1 1 415 0.0E+00
sp|Q872T7|HPPD_NEUCR 4-hydroxyphenylpyruvate dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23G1.170 PE=3 SV=1 1 415 0.0E+00
sp|O42764|HPPD_ZYMTR 4-hydroxyphenylpyruvate dioxygenase OS=Zymoseptoria tritici GN=HPPD PE=3 SV=1 26 415 5.0E-177
sp|Q4WHU1|HPPD1_ASPFU Probable 4-hydroxyphenylpyruvate dioxygenase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G04200 PE=3 SV=1 1 415 8.0E-172
sp|Q6CDR5|HPPD_YARLI 4-hydroxyphenylpyruvate dioxygenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B21846g PE=3 SV=1 31 415 5.0E-167
sp|E9CWP5|HPPD_COCPS 4-hydroxyphenylpyruvate dioxygenase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=TCRP PE=3 SV=1 1 415 6.0E-167
sp|P0CW94|HPPD_COCP7 4-hydroxyphenylpyruvate dioxygenase OS=Coccidioides posadasii (strain C735) GN=TCRP PE=2 SV=1 1 415 6.0E-167
sp|Q1E803|HPPD_COCIM 4-hydroxyphenylpyruvate dioxygenase OS=Coccidioides immitis (strain RS) GN=TCRP PE=3 SV=1 1 415 2.0E-166
sp|Q4WPV8|HPPD2_ASPFU Probable 4-hydroxyphenylpyruvate dioxygenase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G10620 PE=3 SV=1 32 415 3.0E-157
sp|Q27203|HPPD_TETTH 4-hydroxyphenylpyruvate dioxygenase OS=Tetrahymena thermophila GN=TFA PE=3 SV=1 18 415 9.0E-135
sp|P32754|HPPD_HUMAN 4-hydroxyphenylpyruvate dioxygenase OS=Homo sapiens GN=HPD PE=1 SV=2 32 415 3.0E-134
sp|Q5EA20|HPPD_BOVIN 4-hydroxyphenylpyruvate dioxygenase OS=Bos taurus GN=HPD PE=2 SV=3 32 415 8.0E-134
sp|P32755|HPPD_RAT 4-hydroxyphenylpyruvate dioxygenase OS=Rattus norvegicus GN=Hpd PE=1 SV=3 32 415 1.0E-132
sp|Q6TGZ5|HPPD_DANRE 4-hydroxyphenylpyruvate dioxygenase OS=Danio rerio GN=hpd PE=2 SV=1 30 415 4.0E-132
sp|Q5BKL0|HPPD_XENTR 4-hydroxyphenylpyruvate dioxygenase OS=Xenopus tropicalis GN=hpd PE=2 SV=1 32 415 2.0E-131
sp|P49429|HPPD_MOUSE 4-hydroxyphenylpyruvate dioxygenase OS=Mus musculus GN=Hpd PE=1 SV=3 32 415 3.0E-130
sp|Q76NV5|HPPD_DICDI 4-hydroxyphenylpyruvate dioxygenase OS=Dictyostelium discoideum GN=hpd PE=1 SV=1 34 415 6.0E-130
sp|Q22633|HPPD_CAEEL 4-hydroxyphenylpyruvate dioxygenase OS=Caenorhabditis elegans GN=hpd-1 PE=3 SV=1 32 415 2.0E-124
sp|Q60Y65|HPPD_CAEBR 4-hydroxyphenylpyruvate dioxygenase OS=Caenorhabditis briggsae GN=hpd-1 PE=3 SV=1 30 415 2.0E-123
sp|Q02110|HPPD_PIG 4-hydroxyphenylpyruvate dioxygenase OS=Sus scrofa GN=HPD PE=1 SV=4 32 415 4.0E-115
sp|Q9S2F4|HPPD_STRCO 4-hydroxyphenylpyruvate dioxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hpd PE=3 SV=1 34 415 4.0E-100
sp|Q53586|HPPD_STRAW 4-hydroxyphenylpyruvate dioxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hpd PE=1 SV=2 34 415 1.0E-98
sp|Q18347|YBWL_CAEEL Putative protein C31H2.4 OS=Caenorhabditis elegans GN=C31H2.4 PE=3 SV=1 37 415 8.0E-84
sp|P93836|HPPD_ARATH 4-hydroxyphenylpyruvate dioxygenase OS=Arabidopsis thaliana GN=HPD PE=1 SV=2 35 406 8.0E-50
sp|O23920|HPPD_DAUCA 4-hydroxyphenylpyruvate dioxygenase OS=Daucus carota PE=2 SV=1 35 387 2.0E-48
sp|Q9ARF9|HPPD_PLESU 4-hydroxyphenylpyruvate dioxygenase OS=Plectranthus scutellarioides PE=2 SV=1 35 410 2.0E-48
sp|O52791|HMAS_AMYOR 4-hydroxymandelate synthase OS=Amycolatopsis orientalis PE=1 SV=1 116 409 5.0E-44
sp|O48604|HPPD_HORVU 4-hydroxyphenylpyruvate dioxygenase OS=Hordeum vulgare PE=2 SV=1 35 387 4.0E-40
sp|P23996|MELA_SHECO Protein MelA OS=Shewanella colwelliana GN=melA PE=2 SV=1 121 415 2.0E-36
sp|O06695|VLLY_VIBVU Hemolysin VllY OS=Vibrio vulnificus (strain CMCP6) GN=vllY PE=3 SV=2 121 415 1.0E-34
sp|Q5ZT84|LLY_LEGPH 4-hydroxyphenylpyruvate dioxygenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lly PE=1 SV=2 116 415 6.0E-33
sp|P69053|LLY_LEGPC 4-hydroxyphenylpyruvate dioxygenase OS=Legionella pneumophila (strain Corby) GN=lly PE=3 SV=2 116 415 1.0E-32
sp|Q96IR7|HPDL_HUMAN 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens GN=HPDL PE=1 SV=1 37 412 7.0E-32
sp|Q9I576|HPPD_PSEAE 4-hydroxyphenylpyruvate dioxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hpd PE=3 SV=1 114 413 8.0E-32
sp|Q55810|Y090_SYNY3 Uncharacterized protein slr0090 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0090 PE=3 SV=1 35 411 2.0E-30
sp|Q5XIH9|HPDL_RAT 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Rattus norvegicus GN=Hpdl PE=2 SV=1 37 408 9.0E-30
sp|Q8K248|HPDL_MOUSE 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Mus musculus GN=Hpdl PE=2 SV=1 37 408 1.0E-29
sp|Q557J8|HPDL_DICDI Uncharacterized 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Dictyostelium discoideum GN=hpdl-1 PE=3 SV=1 36 408 3.0E-28
sp|P80064|HPPD_PSEUJ 4-hydroxyphenylpyruvate dioxygenase OS=Pseudomonas sp. (strain P.J. 874) GN=hpd PE=1 SV=1 121 415 8.0E-28
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2912
MAPSAVSPQQRAVDEQQQQPSGDFSIQGDANFTGYDHITWWVGNAKQAASYYTSLFGFTPVAYRGLETGSRYFSA
HVVANRGVCFVFVSPVRSAAHLGQDEGISAADKRLLLEMHAHLERHGDAVKDVAFVVDNVEGVFEKAVKEGAVAV
QPPMVMGDDQDGSVVTAVINTYGDTTHTLINRGSYSGPFLPGYRRAKPSTATVALPEVPLARIDHCVGNQDWDQM
VSACAFYEQCLSFHRFWSVDDSQVCTEFSALRSIVMASPNNLVKMPINEPAPGKKRSQIEEYYIFNSGPGVQHIA
LLTHDIITAVSALRARGVDFINVPASYYMTLRQRLKTERRTWELHEDLDTIERLNILIDYDEGGYLLQLFTKPLL
DRPTVFIEIIQRHDFEGFGAGNFKSLFEAIEREQEERGNL*
Coding >OphauG2|2912
ATGGCTCCTTCAGCAGTTTCTCCGCAGCAACGTGCTGTGGACGAGCAGCAGCAGCAGCCCAGTGGCGACTTTAGC
ATCCAAGGCGACGCCAACTTTACAGGCTATGACCATATAACGTGGTGGGTGGGCAACGCCAAGCAGGCGGCCTCA
TACTACACCAGTCTGTTTGGTTTCACGCCCGTTGCCTACCGGGGGCTCGAGACGGGCAGCAGGTACTTTTCGGCA
CACGTCGTGGCCAACAGGGGCGTGTGTTTTGTCTTTGTGTCCCCCGTCCGCTCAGCCGCGCATCTGGGACAAGAC
GAAGGCATTTCGGCAGCCGACAAGAGGCTCCTGCTGGAAATGCATGCCCACCTGGAACGGCACGGCGATGCCGTC
AAGGACGTGGCTTTCGTCGTGGACAATGTGGAGGGAGTCTTTGAAAAGGCGGTCAAGGAGGGCGCGGTGGCGGTG
CAGCCGCCCATGGTGATGGGCGACGACCAGGATGGAAGTGTCGTGACGGCCGTCATCAACACATATGGGGACACG
ACGCACACCCTCATCAACCGCGGCTCCTACTCGGGGCCCTTTTTGCCTGGCTATCGCCGGGCCAAGCCGTCGACA
GCCACGGTGGCGCTACCAGAGGTGCCGCTGGCACGCATAGACCACTGCGTCGGCAACCAGGACTGGGACCAGATG
GTCTCGGCCTGCGCCTTTTACGAACAATGCCTCTCTTTCCACCGCTTCTGGTCTGTAGACGACTCGCAAGTATGC
ACCGAGTTTTCGGCCCTCAGGTCCATCGTCATGGCCTCGCCCAACAACCTCGTCAAAATGCCCATCAATGAGCCT
GCTCCGGGTAAGAAGCGCTCCCAGATTGAGGAGTATTACATCTTCAACTCGGGGCCCGGCGTGCAGCACATTGCC
CTGCTCACGCACGACATCATCACGGCCGTGTCGGCGCTGCGTGCCCGCGGCGTCGACTTTATCAACGTTCCTGCC
TCGTACTACATGACCCTGCGCCAGCGCCTCAAGACGGAGCGGCGGACCTGGGAGTTGCATGAGGATCTCGACACC
ATTGAGCGTCTCAACATCCTCATCGACTATGACGAGGGCGGTTATCTCTTGCAGCTCTTTACTAAGCCCCTCTTG
GACCGCCCTACCGTCTTTATCGAGATTATTCAGCGTCACGACTTTGAAGGCTTTGGCGCTGGCAATTTCAAGAGT
CTATTCGAGGCCATTGAGCGAGAACAAGAAGAACGCGGCAATCTCTAA
Transcript >OphauG2|2912
ATGGCTCCTTCAGCAGTTTCTCCGCAGCAACGTGCTGTGGACGAGCAGCAGCAGCAGCCCAGTGGCGACTTTAGC
ATCCAAGGCGACGCCAACTTTACAGGCTATGACCATATAACGTGGTGGGTGGGCAACGCCAAGCAGGCGGCCTCA
TACTACACCAGTCTGTTTGGTTTCACGCCCGTTGCCTACCGGGGGCTCGAGACGGGCAGCAGGTACTTTTCGGCA
CACGTCGTGGCCAACAGGGGCGTGTGTTTTGTCTTTGTGTCCCCCGTCCGCTCAGCCGCGCATCTGGGACAAGAC
GAAGGCATTTCGGCAGCCGACAAGAGGCTCCTGCTGGAAATGCATGCCCACCTGGAACGGCACGGCGATGCCGTC
AAGGACGTGGCTTTCGTCGTGGACAATGTGGAGGGAGTCTTTGAAAAGGCGGTCAAGGAGGGCGCGGTGGCGGTG
CAGCCGCCCATGGTGATGGGCGACGACCAGGATGGAAGTGTCGTGACGGCCGTCATCAACACATATGGGGACACG
ACGCACACCCTCATCAACCGCGGCTCCTACTCGGGGCCCTTTTTGCCTGGCTATCGCCGGGCCAAGCCGTCGACA
GCCACGGTGGCGCTACCAGAGGTGCCGCTGGCACGCATAGACCACTGCGTCGGCAACCAGGACTGGGACCAGATG
GTCTCGGCCTGCGCCTTTTACGAACAATGCCTCTCTTTCCACCGCTTCTGGTCTGTAGACGACTCGCAAGTATGC
ACCGAGTTTTCGGCCCTCAGGTCCATCGTCATGGCCTCGCCCAACAACCTCGTCAAAATGCCCATCAATGAGCCT
GCTCCGGGTAAGAAGCGCTCCCAGATTGAGGAGTATTACATCTTCAACTCGGGGCCCGGCGTGCAGCACATTGCC
CTGCTCACGCACGACATCATCACGGCCGTGTCGGCGCTGCGTGCCCGCGGCGTCGACTTTATCAACGTTCCTGCC
TCGTACTACATGACCCTGCGCCAGCGCCTCAAGACGGAGCGGCGGACCTGGGAGTTGCATGAGGATCTCGACACC
ATTGAGCGTCTCAACATCCTCATCGACTATGACGAGGGCGGTTATCTCTTGCAGCTCTTTACTAAGCCCCTCTTG
GACCGCCCTACCGTCTTTATCGAGATTATTCAGCGTCACGACTTTGAAGGCTTTGGCGCTGGCAATTTCAAGAGT
CTATTCGAGGCCATTGAGCGAGAACAAGAAGAACGCGGCAATCTCTAA
Gene >OphauG2|2912
ATGGCTCCTTCAGCAGTTTCTCCGCAGCAACGTGCTGTGGACGAGCAGCAGCAGCAGCCCAGTGGCGACTTTAGC
ATCCAAGGCGACGCCAACTTTACAGGCTATGACCATATAACGTGGTGGGTGGGCAACGCCAAGCAGGCGGCCTCA
TACTACACCAGTCTGTTTGGTTTCACGCCCGTTGCCTACCGGGGGCTCGAGACGGGCAGCAGGTACTTTTCGGCA
CACGTCGTGGCCAACAGGGGCGTGTGTTTTGTCTTTGTGTCCCCCGTCCGCTCAGCCGCGCATCTGGGACAAGAC
GAAGGCATTTCGGCAGCCGACAAGAGGCTCCTGCTGGAAATGCATGCCCACCTGGAACGGCACGGCGATGCCGTC
AAGGACGTGGCTTTCGTCGTGGACAATGTGGAGGGAGTCTTTGAAAAGGCGGTCAAGGAGGGCGCGGTGGCGGTG
CAGCCGCCCATGGTGATGGGCGACGACCAGGATGGAAGTGTCGTGACGGCCGTCATCAACACATATGGGGACACG
ACGCACACCCTCATCAACCGCGGCTCCTACTCGGGGCCCTTTTTGCCTGGCTATCGCCGGGCCAAGCCGTCGACA
GCCACGGTGGCGCTACCAGAGGTGCCGCTGGCACGCATAGACCACTGCGTCGGCAACCAGGACTGGGACCAGATG
GTCTCGGCCTGCGCCTTTTACGAACAATGCCTCTCTTTCCACCGCTTCTGGTCTGTAGACGACTCGCAAGTATGC
ACCGAGTTTTCGGCCCTCAGGTCCATCGTCATGGCCTCGCCCAACAACCTCGTCAAAATGCCCATCAATGAGCCT
GCTCCGGGTAAGAAGCGCTCCCAGATTGAGGAGTATTACATCTTCAACTCGGGGCCCGGCGTGCAGCACATTGCC
CTGCTCACGCACGACATCATCACGGCCGTGTCGGCGCTGCGTGCCCGCGGCGTCGACTTTATCAACGTTCCTGCC
TCGTACTACATGACCCTGCGCCAGCGCCTCAAGACGGAGCGGCGGACCTGGGAGTTGCATGAGGATCTCGACACC
ATTGAGCGTCTCAACATCCTCATCGACTATGACGAGGGCGGTTATCTCTTGCAGCTCTTTACTAAGCCCCTCTTG
GACCGCCCTACCGTCTTTATCGAGATTATTCAGCGTCACGACTTTGAAGGCTTTGGCGCTGGCAATTTCAAGAGT
CTATTCGAGGCCATTGAGCGAGAACAAGAAGAACGCGGCAATCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail