Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|290
Gene name
LocationContig_1061:1196..2516
Strand-
Gene length (bp)1320
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 1.2E-17 256 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 249 409 2.0E-18
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 250 409 3.0E-15
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 251 409 3.0E-15
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 256 409 9.0E-15
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 245 409 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 249 409 2.0E-18
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 250 409 3.0E-15
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 251 409 3.0E-15
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 256 409 9.0E-15
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 245 409 1.0E-14
sp|Q9H4G4|GAPR1_HUMAN Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3 245 409 2.0E-14
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 255 409 3.0E-14
sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1 256 402 6.0E-14
sp|Q9CWG1|GLIP1_MOUSE Glioma pathogenesis-related protein 1 OS=Mus musculus GN=Glipr1 PE=2 SV=1 255 385 1.0E-13
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 253 399 2.0E-13
sp|P11670|PRB1_TOBAC Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1 256 402 4.0E-13
sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1 256 402 4.0E-13
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 256 398 7.0E-13
sp|Q6UWM5|GPRL1_HUMAN GLIPR1-like protein 1 OS=Homo sapiens GN=GLIPR1L1 PE=1 SV=2 249 400 2.0E-12
sp|Q9ET66|PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus GN=Pi16 PE=2 SV=1 243 401 3.0E-12
sp|Q08697|PR1A_SOLLC Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1 256 407 8.0E-12
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 256 402 1.0E-11
sp|Q58D34|PI16_BOVIN Peptidase inhibitor 16 OS=Bos taurus GN=PI16 PE=2 SV=1 252 402 2.0E-11
sp|P33154|PR1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1 256 398 4.0E-11
sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1 256 402 4.0E-11
sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3 256 402 9.0E-11
sp|Q6UXB8|PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens GN=PI16 PE=1 SV=1 252 402 1.0E-10
sp|Q59PV6|PRY1_CANAL Secreted protein PRY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRY1 PE=1 SV=1 256 409 1.0E-10
sp|A9YME1|VA5_MICHY Venom allergen 5 OS=Microctonus hyperodae PE=2 SV=1 252 401 2.0E-10
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 212 409 2.0E-10
sp|W4VS53|CRVP_TRILK CRISP/Allergen/PR-1 OS=Trittame loki PE=1 SV=1 252 399 4.0E-10
sp|F8J2D4|CRVP_DRYCN Cysteine-rich venom protein OS=Drysdalia coronoides PE=1 SV=1 246 403 5.0E-10
sp|Q2XXQ0|CRVP_ERYPO Cysteine-rich venom protein LIO1 (Fragment) OS=Erythrolamprus poecilogyrus PE=2 SV=1 246 402 5.0E-10
sp|C0ITL3|VA5_PACCH Venom allergen 5 (Fragment) OS=Pachycondyla chinensis PE=2 SV=1 237 401 5.0E-10
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 230 402 7.0E-10
sp|Q3SB04|CRVP_NOTSC Cysteine-rich venom protein pseudechetoxin-like OS=Notechis scutatus scutatus PE=2 SV=1 246 403 9.0E-10
sp|Q32LB5|GPRL1_BOVIN GLIPR1-like protein 1 OS=Bos taurus GN=GLIPR1L1 PE=2 SV=1 235 398 1.0E-09
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 259 402 2.0E-09
sp|Q2L6Z1|VAL5_VESMC Venom allergen 5 OS=Vespula maculifrons PE=2 SV=1 256 404 2.0E-09
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 259 402 3.0E-09
sp|P35782|VA52_VESCR Venom allergen 5.02 OS=Vespa crabro PE=1 SV=1 256 402 3.0E-09
sp|P86870|VA5_VESMG Venom allergen 5 OS=Vespa magnifica PE=1 SV=2 232 402 4.0E-09
sp|A8S6B6|CRVP_AUSSU Cysteine-rich venom protein OS=Austrelaps superbus PE=2 SV=1 250 403 4.0E-09
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 213 402 4.0E-09
sp|Q3SB05|CRVP_PSETE Cysteine-rich venom protein pseudechetoxin-like OS=Pseudonaja textilis PE=1 SV=1 250 403 5.0E-09
sp|P35795|SC14_SCHCO Fruiting body protein SC14 OS=Schizophyllum commune GN=SC14 PE=2 SV=1 250 399 7.0E-09
sp|Q3SB03|CRVP_HOPST Cysteine-rich venom protein pseudechetoxin-like OS=Hoplocephalus stephensii PE=2 SV=1 250 403 7.0E-09
sp|Q7YT83|TX31_CONTE Cysteine-rich venom protein OS=Conus textile PE=1 SV=1 256 402 8.0E-09
sp|Q8AVA3|CRVP_PSEPO Cysteine-rich venom protein pseudecin OS=Pseudechis porphyriacus PE=1 SV=1 256 403 9.0E-09
sp|Q3SB06|CRVP_OXYMI Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus microlepidotus PE=2 SV=1 246 403 1.0E-08
sp|Q09GJ9|CRVP_PHIOL Cysteine-rich venom protein OS=Philodryas olfersii PE=2 SV=1 247 401 1.0E-08
sp|Q3SB07|CRVP_OXYSC Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 250 403 1.0E-08
sp|Q8JI38|CRVP_LATSE Cysteine-rich venom protein latisemin OS=Laticauda semifasciata PE=2 SV=1 256 403 1.0E-08
sp|P81656|VA5_POLDO Venom allergen 5 OS=Polistes dominula PE=1 SV=2 238 402 2.0E-08
sp|Q2XXQ2|CRVP2_PSEPL Cysteine-rich venom protein ENH2 OS=Pseudoferania polylepis PE=2 SV=1 256 401 2.0E-08
sp|P48060|GLIP1_HUMAN Glioma pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR1 PE=1 SV=3 251 398 2.0E-08
sp|Q2XXQ3|CRVP1_PSEPL Cysteine-rich venom protein ENH1 OS=Pseudoferania polylepis PE=2 SV=1 256 401 3.0E-08
sp|B2MVK7|VA5_RHYBR Venom allergen 5 OS=Rhynchium brunneum PE=2 SV=1 267 407 3.0E-08
sp|Q8AVA4|CRVP_PSEAU Cysteine-rich venom protein pseudechetoxin OS=Pseudechis australis PE=1 SV=1 256 403 4.0E-08
sp|D8VNS1|CRVP_CERRY Cysteine-rich venom protein OS=Cerberus rynchops PE=1 SV=1 256 401 4.0E-08
sp|P0CB15|CRIS_PROFL Serotriflin OS=Protobothrops flavoviridis PE=1 SV=1 256 403 6.0E-08
sp|P35781|VA51_VESCR Venom allergen 5.01 OS=Vespa crabro PE=1 SV=1 256 402 6.0E-08
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 260 401 6.0E-08
sp|Q2XXQ4|CRVP3_DISTY Cysteine-rich venom protein DIS3 OS=Dispholidus typus PE=2 SV=1 256 401 7.0E-08
sp|A6MFK9|CRVP_DEMVE Cysteine-rich venom protein OS=Demansia vestigiata PE=2 SV=1 230 401 7.0E-08
sp|P35783|VA5_VESFL Venom allergen 5 OS=Vespula flavopilosa PE=1 SV=1 256 404 1.0E-07
sp|P35780|VA5_POLFU Venom allergen 5 OS=Polistes fuscatus PE=1 SV=1 238 403 1.0E-07
sp|Q91055|CRVP_HELHO Cysteine-rich venom protein helothermine OS=Heloderma horridum horridum PE=1 SV=1 227 399 1.0E-07
sp|Q8BS03|PI15_MOUSE Peptidase inhibitor 15 OS=Mus musculus GN=Pi15 PE=2 SV=2 256 402 1.0E-07
sp|O43692|PI15_HUMAN Peptidase inhibitor 15 OS=Homo sapiens GN=PI15 PE=1 SV=1 232 402 1.0E-07
sp|O19010|CRIS3_HORSE Cysteine-rich secretory protein 3 OS=Equus caballus GN=CRISP3 PE=1 SV=1 250 398 1.0E-07
sp|P83377|VA5_POLGA Venom allergen 5 OS=Polistes gallicus PE=1 SV=1 238 402 2.0E-07
sp|Q3KPV7|PI15_XENLA Peptidase inhibitor 15 OS=Xenopus laevis GN=pi15 PE=2 SV=1 230 402 2.0E-07
sp|P81657|VA5_VESMA Venom allergen 5 OS=Vespa mandarinia PE=1 SV=1 256 402 2.0E-07
sp|P35784|VA5_VESGE Venom allergen 5 OS=Vespula germanica PE=1 SV=1 256 404 2.0E-07
sp|Q05110|VA5_VESVU Venom allergen 5 OS=Vespula vulgaris PE=1 SV=1 256 404 3.0E-07
sp|Q8UW11|CRVP2_HYDHA Cysteine-rich venom protein 2 OS=Hydrophis hardwickii PE=2 SV=2 246 399 3.0E-07
sp|Q2XXQ5|CRVP2_DISTY Cysteine-rich venom protein DIS2 OS=Dispholidus typus PE=2 SV=1 256 401 4.0E-07
sp|Q2XXQ6|CRVP1_DISTY Cysteine-rich venom protein DIS1 OS=Dispholidus typus PE=2 SV=1 256 401 4.0E-07
sp|A6QLZ7|CRLD2_BOVIN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Bos taurus GN=CRISPLD2 PE=2 SV=1 252 402 4.0E-07
sp|P84808|CRVP2_NAJKA Cysteine-rich venom protein kaouthin-2 OS=Naja kaouthia PE=1 SV=2 256 403 5.0E-07
sp|Q09566|LON1_CAEEL Protein lon-1 OS=Caenorhabditis elegans GN=lon-1 PE=1 SV=1 251 398 5.0E-07
sp|Q7ZZN8|CRVP2_NAJAT Cysteine-rich venom protein natrin-2 OS=Naja atra PE=1 SV=1 256 403 5.0E-07
sp|B3EWZ8|ECT_ACRMI Ectin (Fragment) OS=Acropora millepora PE=1 SV=1 227 407 5.0E-07
sp|Q9H0B8|CRLD2_HUMAN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Homo sapiens GN=CRISPLD2 PE=2 SV=1 252 402 6.0E-07
sp|P35759|VA5_POLEX Venom allergen 5 OS=Polistes exclamans PE=1 SV=2 238 403 6.0E-07
sp|Q98ST6|PI15_CHICK Peptidase inhibitor 15 OS=Gallus gallus GN=PI15 PE=2 SV=1 256 402 7.0E-07
sp|Q05109|VA5_POLAN Venom allergen 5 (Fragment) OS=Polistes annularis PE=1 SV=1 238 403 7.0E-07
sp|P79845|CRVP_PROMU Cysteine-rich venom protein OS=Protobothrops mucrosquamatus PE=2 SV=2 247 402 7.0E-07
sp|P35779|VA3_SOLRI Venom allergen 3 OS=Solenopsis richteri PE=1 SV=2 237 401 8.0E-07
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 287 402 9.0E-07
sp|Q05108|VA5_DOLAR Venom allergen 5 OS=Dolichovespula arenaria PE=1 SV=1 234 368 1.0E-06
sp|A2A5I3|CRSPL_MOUSE Peptidase inhibitor R3HDML OS=Mus musculus GN=R3hdml PE=3 SV=1 241 402 1.0E-06
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 237 401 1.0E-06
sp|Q8JGT9|CRVP_RHATT Cysteine-rich venom protein tigrin OS=Rhabdophis tigrinus tigrinus PE=1 SV=1 247 402 1.0E-06
sp|P35786|VA5_VESSQ Venom allergen 5 OS=Vespula squamosa PE=1 SV=1 234 402 1.0E-06
sp|Q2XXP5|CRVP_TELDH Cysteine-rich venom protein TEL1 (Fragment) OS=Telescopus dhara PE=2 SV=1 245 401 1.0E-06
sp|P35785|VA5_VESPE Venom allergen 5 OS=Vespula pensylvanica PE=1 SV=1 256 404 1.0E-06
sp|Q8BZQ2|CRLD2_MOUSE Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus GN=Crispld2 PE=1 SV=1 256 402 2.0E-06
sp|Q7T141|PI15A_DANRE Peptidase inhibitor 15-A OS=Danio rerio GN=pi15a PE=3 SV=2 256 402 2.0E-06
sp|Q2XXP4|CRVP_TRIBI Cysteine-rich venom protein TRI1 (Fragment) OS=Trimorphodon biscutatus PE=2 SV=1 247 401 2.0E-06
sp|P35787|VA5_VESVI Venom allergen 5 OS=Vespula vidua PE=1 SV=1 256 404 3.0E-06
sp|B7FDI1|CRVP_VIPBE Cysteine-rich venom protein OS=Vipera berus PE=1 SV=1 247 402 3.0E-06
sp|P35760|VA5_VESMC Venom allergen 5 OS=Vespula maculifrons PE=1 SV=1 256 404 3.0E-06
sp|Q2XXP2|CRVPA_VARVA Cysteine-rich venom protein VAR10 (Fragment) OS=Varanus varius PE=2 SV=1 227 402 4.0E-06
sp|P60623|CRVP_TRIST Cysteine-rich venom protein (Fragment) OS=Trimeresurus stejnegeri PE=1 SV=1 247 402 4.0E-06
sp|Q8JI39|CRVP_PROFL Cysteine-rich venom protein triflin OS=Protobothrops flavoviridis PE=1 SV=1 247 402 4.0E-06
sp|Q04108|PR04_SOLLC Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1 256 402 5.0E-06
sp|B7FDI0|CRVP_VIPNI Cysteine-rich venom protein (Fragment) OS=Vipera nikolskii PE=2 SV=1 247 402 5.0E-06
sp|Q8UW25|CRVP1_HYDHA Cysteine-rich venom protein 1 OS=Hydrophis hardwickii PE=2 SV=2 246 399 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|290
MRVALLTLALPLAQAVPQHLPTRDLETRDVRNPSWDGPKPNRAWDGPSPNPADDGPSPNPAWDGPEPNPADDGPE
PNPEWDGPGRGTRSNQIKPNQNPRPKPQPAANPKPQPKSGPMTYDDMMAALVEMGMDSTQRSQIEELLRSTKDSS
TFELTMDTPPEAQDSANPESPPTVNIQQKPKEEKPKEEKPKANQEAPKPKQPAPPKPAPPKPKQPAPPPPPPAQP
KAKNVQKPKAPTSPKPSPNKSRGPDIKDLALEKHNSYRSKHNAGPLEWDDYLADEAMAWIMQLEQCILRHPQMGE
KEYGQNLASASFTWAPTEQEFLDNTANGIDGWYDEVKIHDFSSNSFIYATGHFTQLVWKGSKRLGCATRFCDGAK
GETREGPAFNATVTACHYYPPGNMGGEFLQNVSP*
Coding >OphauG2|290
ATGCGCGTCGCTCTTTTAACTCTGGCTTTGCCTCTGGCCCAGGCAGTTCCTCAGCATCTGCCAACCAGGGACCTT
GAGACTCGCGATGTCAGGAACCCATCGTGGGATGGCCCCAAGCCAAACCGCGCTTGGGACGGTCCCTCTCCAAAT
CCCGCTGACGACGGTCCTTCACCAAACCCAGCATGGGACGGCCCTGAGCCAAATCCCGCCGACGACGGCCCTGAG
CCAAATCCCGAATGGGACGGGCCTGGACGAGGAACAAGGTCGAACCAAATCAAGCCGAATCAGAACCCTCGTCCC
AAGCCTCAGCCAGCCGCCAATCCCAAGCCTCAGCCTAAATCCGGGCCCATGACGTATGACGACATGATGGCTGCT
CTGGTTGAGATGGGCATGGATTCCACTCAACGCAGCCAAATCGAGGAGCTTCTCAGGTCGACCAAGGACTCTTCC
ACGTTTGAGTTGACCATGGACACTCCCCCCGAGGCGCAGGACTCTGCAAACCCCGAGTCGCCTCCTACGGTCAAT
ATCCAGCAAAAGCCCAAGGAGGAAAAGCCCAAGGAGGAAAAGCCCAAAGCCAACCAGGAAGCTCCCAAGCCCAAG
CAGCCAGCTCCTCCCAAGCCAGCGCCTCCCAAGCCCAAGCAGCCAGCTCCTCCTCCTCCTCCTCCCGCTCAGCCC
AAAGCCAAAAATGTCCAAAAACCAAAGGCCCCTACTTCGCCAAAGCCCAGCCCCAACAAGTCTCGCGGCCCAGAC
ATCAAAGACTTGGCTCTTGAAAAACACAACAGCTACCGCAGCAAGCACAACGCCGGCCCCTTGGAGTGGGACGAC
TACCTCGCCGACGAAGCCATGGCTTGGATCATGCAACTCGAGCAATGCATCCTGCGCCACCCTCAGATGGGCGAA
AAGGAATACGGCCAGAACCTTGCCTCGGCCTCCTTTACCTGGGCCCCGACCGAGCAGGAGTTTCTTGACAACACG
GCCAACGGCATTGATGGCTGGTACGACGAGGTCAAGATTCACGACTTTTCAAGCAATTCCTTTATTTACGCGACG
GGGCACTTTACCCAGCTTGTGTGGAAGGGGTCGAAGCGTCTTGGATGCGCGACTCGCTTCTGCGATGGCGCAAAG
GGCGAGACTCGCGAGGGCCCTGCGTTTAACGCTACCGTGACTGCCTGCCACTATTACCCTCCTGGCAACATGGGA
GGCGAGTTCCTTCAAAACGTTTCGCCGTAA
Transcript >OphauG2|290
ATGCGCGTCGCTCTTTTAACTCTGGCTTTGCCTCTGGCCCAGGCAGTTCCTCAGCATCTGCCAACCAGGGACCTT
GAGACTCGCGATGTCAGGAACCCATCGTGGGATGGCCCCAAGCCAAACCGCGCTTGGGACGGTCCCTCTCCAAAT
CCCGCTGACGACGGTCCTTCACCAAACCCAGCATGGGACGGCCCTGAGCCAAATCCCGCCGACGACGGCCCTGAG
CCAAATCCCGAATGGGACGGGCCTGGACGAGGAACAAGGTCGAACCAAATCAAGCCGAATCAGAACCCTCGTCCC
AAGCCTCAGCCAGCCGCCAATCCCAAGCCTCAGCCTAAATCCGGGCCCATGACGTATGACGACATGATGGCTGCT
CTGGTTGAGATGGGCATGGATTCCACTCAACGCAGCCAAATCGAGGAGCTTCTCAGGTCGACCAAGGACTCTTCC
ACGTTTGAGTTGACCATGGACACTCCCCCCGAGGCGCAGGACTCTGCAAACCCCGAGTCGCCTCCTACGGTCAAT
ATCCAGCAAAAGCCCAAGGAGGAAAAGCCCAAGGAGGAAAAGCCCAAAGCCAACCAGGAAGCTCCCAAGCCCAAG
CAGCCAGCTCCTCCCAAGCCAGCGCCTCCCAAGCCCAAGCAGCCAGCTCCTCCTCCTCCTCCTCCCGCTCAGCCC
AAAGCCAAAAATGTCCAAAAACCAAAGGCCCCTACTTCGCCAAAGCCCAGCCCCAACAAGTCTCGCGGCCCAGAC
ATCAAAGACTTGGCTCTTGAAAAACACAACAGCTACCGCAGCAAGCACAACGCCGGCCCCTTGGAGTGGGACGAC
TACCTCGCCGACGAAGCCATGGCTTGGATCATGCAACTCGAGCAATGCATCCTGCGCCACCCTCAGATGGGCGAA
AAGGAATACGGCCAGAACCTTGCCTCGGCCTCCTTTACCTGGGCCCCGACCGAGCAGGAGTTTCTTGACAACACG
GCCAACGGCATTGATGGCTGGTACGACGAGGTCAAGATTCACGACTTTTCAAGCAATTCCTTTATTTACGCGACG
GGGCACTTTACCCAGCTTGTGTGGAAGGGGTCGAAGCGTCTTGGATGCGCGACTCGCTTCTGCGATGGCGCAAAG
GGCGAGACTCGCGAGGGCCCTGCGTTTAACGCTACCGTGACTGCCTGCCACTATTACCCTCCTGGCAACATGGGA
GGCGAGTTCCTTCAAAACGTTTCGCCGTAA
Gene >OphauG2|290
ATGCGCGTCGCTCTTTTAACTCTGGCTTTGCCTCTGGCCCAGGCAGTTCCTCAGCATCTGCCAACCAGGGACCTT
GAGACTCGCGATGTCAGGAACCCATCGTGGGATGGCCCCAAGCCAAACCGCGCTTGGGACGGTCCCTCTCCAAAT
CCCGCTGACGACGGTCCTTCACCAAACCCAGCATGGGACGGCCCTGAGCCAAATCCCGCCGACGACGGCCCTGAG
CCAAATCCCGAATGGGACGGGCCTGGACGAGGAACAAGGTCGAACCAAATCAAGCCGAATCAGAACCCTCGTCCC
AAGCCTCAGCCAGCCGCCAATCCCAAGCCTCAGCCTAAATCCGGGCCCATGACGTATGACGACATGATGGCTGCT
CTGGTTGAGATGGGCATGGATTCCACTCAACGCAGCCAAATCGAGGAGCTTCTCAGGTCGACCAAGGACTCTTCC
ACGTTTGAGTTGACCATGGACACTCCCCCCGAGGCGCAGGACTCTGCAAACCCCGAGTCGCCTCCTACGGTCAAT
ATCCAGCAAAAGCCCAAGGAGGAAAAGCCCAAGGAGGAAAAGCCCAAAGCCAACCAGGAAGCTCCCAAGCCCAAG
CAGCCAGCTCCTCCCAAGCCAGCGCCTCCCAAGCCCAAGCAGCCAGCTCCTCCTCCTCCTCCTCCCGCTCAGCCC
AAAGCCAAAAATGTCCAAAAACCAAAGGCCCCTACTTCGCCAAAGCCCAGCCCCAACAAGTCTCGCGGCCCAGAC
ATCAAAGACTTGGCTCTTGAAAAACACAACAGCTACCGCAGCAAGCACAACGCCGGCCCCTTGGAGTGGGACGAC
TACCTCGCCGACGAAGCCATGGCTTGGATCATGCAACTCGAGCAATGCATCCTGCGCCACCCTCAGATGGGCGAA
AAGGAATACGGCCAGAACCTTGCCTCGGCCTCCTTTACCTGGGCCCCGACCGAGCAGGAGTTTCTTGACAACACG
GCCAACGGCATTGATGGCTGGTACGACGAGGTCAAGATTCACGACTTTTCAAGCAATTCCTTTATTTACGCGACG
GGGCACTTTACCCAGCTTGTGTGGAAGGGGTCGAAGCGTCTTGGATGCGCGACTCGCTTCTGCGATGGCGCAAAG
GGCGAGACTCGCGAGGGCCCTGCGTTTAACGCTACCGTGACTGCCTGCCACTATTACCCTCCTGGTAAGTCTATT
TTTTTTTCTCCTTTTTCATTCAAAGAATAAAGCGAACAAGAGAAGAAGAAGAAAACAGTGCTGACAGTTTTTGAA
AAAGGCAACATGGGAGGCGAGTTCCTTCAAAACGTTTCGCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail