Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|29
Gene name
LocationContig_1:71389..73433
Strand-
Gene length (bp)2044
Transcript length (bp)1986
Coding sequence length (bp)1986
Protein length (aa) 662

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00285 Citrate_synt Citrate synthase, C-terminal domain 4.5E-17 433 628
PF02629 CoA_binding CoA binding domain 1.6E-18 43 148
PF00549 Ligase_CoA CoA-ligase 3.0E-14 208 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93988|ACL1_SORMK ATP-citrate synthase subunit 1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=ACL1 PE=3 SV=1 12 661 0.0E+00
sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.310 PE=3 SV=1 4 661 0.0E+00
sp|Q9C522|ACLB1_ARATH ATP-citrate synthase beta chain protein 1 OS=Arabidopsis thaliana GN=ACLB-1 PE=2 SV=1 40 641 0.0E+00
sp|Q9FGX1|ACLB2_ARATH ATP-citrate synthase beta chain protein 2 OS=Arabidopsis thaliana GN=ACLB-2 PE=1 SV=1 40 641 0.0E+00
sp|Q93VT8|ACLB1_ORYSJ ATP-citrate synthase beta chain protein 1 OS=Oryza sativa subsp. japonica GN=ACLB-1 PE=2 SV=1 40 641 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93988|ACL1_SORMK ATP-citrate synthase subunit 1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=ACL1 PE=3 SV=1 12 661 0.0E+00
sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.310 PE=3 SV=1 4 661 0.0E+00
sp|Q9C522|ACLB1_ARATH ATP-citrate synthase beta chain protein 1 OS=Arabidopsis thaliana GN=ACLB-1 PE=2 SV=1 40 641 0.0E+00
sp|Q9FGX1|ACLB2_ARATH ATP-citrate synthase beta chain protein 2 OS=Arabidopsis thaliana GN=ACLB-2 PE=1 SV=1 40 641 0.0E+00
sp|Q93VT8|ACLB1_ORYSJ ATP-citrate synthase beta chain protein 1 OS=Oryza sativa subsp. japonica GN=ACLB-1 PE=2 SV=1 40 641 0.0E+00
sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyostelium discoideum GN=acly PE=1 SV=1 33 643 0.0E+00
sp|P53585|ACLY_CAEEL Probable ATP-citrate synthase OS=Caenorhabditis elegans GN=D1005.1 PE=3 SV=1 40 644 0.0E+00
sp|P16638|ACLY_RAT ATP-citrate synthase OS=Rattus norvegicus GN=Acly PE=1 SV=1 26 645 0.0E+00
sp|Q2TCH3|ACLY_SHEEP ATP-citrate synthase OS=Ovis aries GN=ACLY PE=2 SV=1 26 645 0.0E+00
sp|Q91V92|ACLY_MOUSE ATP-citrate synthase OS=Mus musculus GN=Acly PE=1 SV=1 26 645 0.0E+00
sp|P53396|ACLY_HUMAN ATP-citrate synthase OS=Homo sapiens GN=ACLY PE=1 SV=3 26 644 0.0E+00
sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1703.07 PE=1 SV=1 36 642 0.0E+00
sp|Q32PF2|ACLY_BOVIN ATP-citrate synthase OS=Bos taurus GN=ACLY PE=2 SV=1 40 645 0.0E+00
sp|P45102|SUCD_HAEIN Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=sucD PE=3 SV=1 86 350 1.0E-25
sp|O26663|SUCD_METTH Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=sucD PE=3 SV=1 40 331 3.0E-24
sp|O28098|SUCD2_ARCFU Succinyl-CoA ligase [ADP-forming] subunit alpha 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sucD2 PE=3 SV=1 40 337 3.0E-23
sp|O28733|SUCD1_ARCFU Succinyl-CoA ligase [ADP-forming] subunit alpha 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sucD1 PE=3 SV=1 40 350 1.0E-22
sp|P68209|SUCA1_ARATH Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Arabidopsis thaliana GN=At5g08300 PE=1 SV=1 34 351 2.0E-22
sp|P53591|SUCD_COXBU Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sucD PE=3 SV=2 40 337 3.0E-22
sp|P0AGE9|SUCD_ECOLI Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli (strain K12) GN=sucD PE=1 SV=2 92 350 6.0E-22
sp|P0AGF1|SUCD_ECO57 Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli O157:H7 GN=sucD PE=3 SV=2 92 350 6.0E-22
sp|P0AGF0|SUCD_ECOL6 Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sucD PE=3 SV=2 92 350 6.0E-22
sp|Q8GTQ9|SUCA1_SOLLC Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Solanum lycopersicum GN=SCOA PE=1 SV=1 1 334 6.0E-22
sp|Q51567|SUCD_PSEAE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sucD PE=3 SV=2 92 348 1.0E-21
sp|Q8LAD2|SUCA2_ARATH Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Arabidopsis thaliana GN=At5g23250 PE=2 SV=2 33 334 9.0E-21
sp|Q6DQL1|SUCA2_SOLLC Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Solanum lycopersicum PE=1 SV=1 33 351 1.0E-20
sp|Q9AKE1|SUCD_RICTY Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucD PE=3 SV=1 40 352 7.0E-20
sp|Q58643|SUCD_METJA Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=sucD PE=1 SV=1 40 351 1.0E-19
sp|O08371|SUCD_RICPR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia prowazekii (strain Madrid E) GN=sucD PE=3 SV=1 40 352 3.0E-19
sp|Q92I22|SUCD_RICCN Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucD PE=3 SV=1 40 351 3.0E-19
sp|P80865|SUCD_BACSU Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Bacillus subtilis (strain 168) GN=sucD PE=1 SV=3 92 355 4.0E-19
sp|Q6ZL94|SUCA_ORYSJ Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0577700 PE=1 SV=1 36 351 6.0E-19
sp|Q4ULQ8|SUCD_RICFE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucD PE=3 SV=1 40 351 2.0E-18
sp|P09143|SUCD_THETH Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Thermus thermophilus GN=sucD PE=1 SV=1 40 347 3.0E-18
sp|Q7U0Z0|SUCD_MYCBO Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sucD PE=3 SV=1 98 337 4.0E-18
sp|P9WGC7|SUCD_MYCTU Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sucD PE=1 SV=1 98 337 4.0E-18
sp|P9WGC6|SUCD_MYCTO Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sucD PE=3 SV=1 98 337 4.0E-18
sp|P53595|MTKB_METEA Malate--CoA ligase subunit alpha OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=mtkB PE=3 SV=2 92 338 6.0E-18
sp|Q1RH56|SUCD_RICBR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia bellii (strain RML369-C) GN=sucD PE=3 SV=1 40 341 6.0E-18
sp|P13086|SUCA_RAT Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Rattus norvegicus GN=Suclg1 PE=2 SV=2 138 351 2.0E-16
sp|Q5HPU4|SUCD_STAEQ Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=sucD PE=3 SV=1 39 353 2.0E-16
sp|Q8CPH4|SUCD_STAES Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus epidermidis (strain ATCC 12228) GN=sucD PE=3 SV=1 39 353 3.0E-16
sp|Q8NX01|SUCD_STAAW Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain MW2) GN=sucD PE=3 SV=1 39 353 4.0E-16
sp|Q6G9W7|SUCD_STAAS Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain MSSA476) GN=sucD PE=3 SV=1 39 353 4.0E-16
sp|P99070|SUCD_STAAN Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain N315) GN=sucD PE=1 SV=1 39 353 4.0E-16
sp|P66866|SUCD_STAAM Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sucD PE=3 SV=1 39 353 4.0E-16
sp|Q5HGI6|SUCD_STAAC Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain COL) GN=sucD PE=3 SV=1 39 353 4.0E-16
sp|Q6GHI9|SUCD_STAAR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain MRSA252) GN=sucD PE=3 SV=1 39 345 8.0E-16
sp|O13750|SUCA_SCHPO Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.17c PE=3 SV=1 142 352 3.0E-15
sp|P53596|SUCA_CAEEL Probable succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=C05G5.4 PE=3 SV=1 41 345 2.0E-14
sp|P53400|SUCA2_TRIVA Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial OS=Trichomonas vaginalis GN=ALPHA-SCS2 PE=3 SV=1 98 358 3.0E-13
sp|Q94522|SUCA_DROME Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Drosophila melanogaster GN=Scsalpha PE=2 SV=3 86 341 5.0E-13
sp|P53598|SUCA_YEAST Succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSC1 PE=1 SV=1 99 334 5.0E-13
sp|P53401|SUCA3_TRIVA Succinyl-CoA ligase [GDP-forming] subunit alpha-3, mitochondrial OS=Trichomonas vaginalis GN=ALPHA-SCS3 PE=3 SV=1 98 358 2.0E-11
sp|P53399|SUCA1_TRIVA Succinyl-CoA ligase [GDP-forming] subunit alpha-1, mitochondrial OS=Trichomonas vaginalis GN=ALPHA-SCS1 PE=3 SV=1 92 358 6.0E-11
sp|P36967|SUCA_DICDI Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=scsA PE=1 SV=3 86 334 9.0E-11
sp|Q9WUM5|SUCA_MOUSE Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus GN=Suclg1 PE=1 SV=4 138 351 2.0E-10
sp|Q9YGD2|SUCA_COLLI Succinyl-CoA ligase subunit alpha, mitochondrial (Fragment) OS=Columba livia GN=SUCLG1 PE=1 SV=1 86 351 4.0E-10
sp|Q9P727|SUCA_NEUCR Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=8D4.130 PE=3 SV=1 99 349 6.0E-10
sp|O19069|SUCA_PIG Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Sus scrofa GN=SUCLG1 PE=1 SV=2 138 351 1.0E-09
sp|Q58DR8|SUCA_BOVIN Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Bos taurus GN=SUCLG1 PE=2 SV=3 138 351 2.0E-09
sp|O67547|SUCD_AQUAE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Aquifex aeolicus (strain VF5) GN=sucD PE=3 SV=1 40 334 1.0E-08
sp|P53597|SUCA_HUMAN Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens GN=SUCLG1 PE=1 SV=4 142 351 3.0E-08
sp|D4GS06|CISY_HALVD Citrate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=citZ PE=1 SV=1 435 624 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0046912 acyltransferase activity, acyl groups converted into alkyl on transfer Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016746 acyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1546
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|29 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1569
Ophiocordyceps camponoti-floridani Ophcf2|05764
Ophiocordyceps camponoti-rufipedis Ophun1|7343
Ophiocordyceps kimflemingae Ophio5|5973
Ophiocordyceps subramaniannii Hirsu2|1127

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|29
MAQASSSAAAGAKGQLSANDNIQRFAAPSRPLSPLPEHALFNDKTRCFVYGLQPRAVQGMLDFDFICKRKTPSVA
GIVYTFGGQFVSKMYWGTSETLLPVYQEVSKAISKHPDVDVVVNFASSRSVYTSTMELMEHPQIKTIAIIAEGVP
ERRAREIAHVAKKKGVTIIGPATVGGIKPGSFKIGNTGGMMDNIVASKLYRKGSVGYVSKSGGMSNELNNIISQT
TDGVYEGIAIGGDRYPGTTFIDHMLRYQADPECKILVLLGEVGGVEEYKVIDAVNKGIITKPIVAWAIGTCASMF
KTEVQFGHAGSFANSQLETATMKNKMMAEAGIHVPKTFEDMPSVLKNVYEKLVKDGTIKPQPEPVVPKIPIDYSW
AQELGLIRKPAAFISTISDDRGQELLYAGMPISDVFREEIGIGGVMSLLWFRRRLPDYASKFLEMVLMLTADHGP
AVSGAMNTIITTRAGKDLISALVSGLLTIGSRFGGALDGAADEFTRAFDKNLSPREFVDTMRKANKLIPGIGHRI
KSRNNPDLRVELVKEYVLAKFPTHKLLDYALAVETVTTSKKDNLILNVDGCIAVCFVDLLRNCGAFSPEEAEDYL
KMGVLNGLFVLGRSIGLIAHYLDQKRLRTGLYRHPWDDITYLLPNMRDGRPGAEGRVEVQM*
Coding >OphauG2|29
ATGGCTCAAGCTTCTTCAAGCGCCGCTGCTGGCGCAAAGGGCCAGTTGTCTGCAAACGACAACATCCAGCGCTTT
GCTGCGCCCAGTCGCCCTCTCAGCCCTTTGCCAGAGCACGCTCTCTTCAACGACAAGACGCGATGCTTCGTCTAC
GGCCTCCAGCCCCGCGCTGTCCAAGGCATGCTCGACTTCGACTTTATCTGCAAGCGTAAGACGCCTTCAGTCGCC
GGCATCGTCTATACCTTTGGTGGCCAGTTCGTCAGCAAGATGTACTGGGGCACCAGCGAGACCCTCCTGCCCGTG
TACCAGGAGGTCAGCAAGGCTATTAGCAAGCACCCCGACGTCGACGTAGTCGTCAACTTTGCTTCGTCGCGCAGC
GTCTACACCTCCACCATGGAGCTCATGGAGCATCCCCAAATCAAAACCATTGCCATCATTGCCGAGGGCGTCCCC
GAGCGACGAGCCCGTGAGATTGCCCATGTGGCCAAGAAGAAGGGCGTCACCATCATTGGCCCCGCCACTGTCGGT
GGCATCAAGCCCGGCAGCTTCAAGATCGGAAACACCGGTGGCATGATGGACAATATCGTCGCCTCCAAGCTGTAC
CGCAAGGGCTCCGTCGGCTACGTCTCCAAGTCTGGTGGCATGTCCAACGAACTCAACAACATCATTTCTCAGACG
ACTGACGGCGTGTACGAGGGCATTGCAATTGGTGGCGATCGATACCCTGGCACCACCTTCATCGACCATATGCTC
CGCTATCAGGCCGACCCCGAATGCAAAATCCTAGTCTTGCTCGGTGAGGTGGGCGGGGTAGAAGAATACAAGGTG
ATTGACGCTGTCAACAAGGGCATCATCACCAAGCCCATCGTTGCCTGGGCTATCGGTACCTGCGCCAGCATGTTC
AAGACCGAGGTCCAGTTCGGTCACGCTGGCTCCTTTGCCAACTCGCAACTTGAAACTGCTACAATGAAGAACAAG
ATGATGGCTGAGGCCGGCATCCACGTGCCCAAGACATTCGAGGACATGCCCTCGGTCCTCAAGAATGTCTATGAA
AAACTTGTCAAAGACGGCACCATCAAGCCGCAACCCGAGCCTGTCGTGCCCAAGATCCCTATTGACTATTCGTGG
GCTCAAGAGCTCGGCCTCATTCGAAAGCCAGCTGCCTTCATTTCAACCATATCCGACGACCGCGGCCAAGAACTT
CTTTACGCTGGCATGCCCATCTCGGATGTCTTCCGTGAGGAGATTGGCATCGGGGGCGTCATGTCATTGCTTTGG
TTCCGCCGCCGTCTACCAGACTACGCCTCCAAGTTTCTCGAAATGGTACTCATGCTTACCGCAGACCACGGCCCT
GCAGTATCTGGAGCCATGAACACCATCATCACCACGCGTGCCGGAAAAGACCTCATCAGTGCTCTTGTTTCTGGT
CTGTTGACGATTGGCTCCCGCTTTGGCGGTGCGCTGGATGGAGCCGCCGACGAGTTCACCAGAGCCTTTGACAAG
AACTTGAGCCCACGCGAATTTGTTGACACCATGCGAAAAGCCAACAAGCTCATACCCGGCATTGGCCACCGCATC
AAGTCGCGCAATAATCCTGACTTGCGTGTCGAACTCGTCAAAGAGTATGTCTTGGCAAAATTTCCTACCCATAAG
CTCCTCGACTACGCTCTGGCTGTTGAGACTGTCACAACGTCGAAAAAGGACAATCTCATTCTCAACGTGGATGGA
TGTATTGCCGTTTGTTTTGTGGATTTGCTACGCAATTGCGGTGCCTTTTCCCCAGAAGAGGCCGAGGACTATCTG
AAGATGGGCGTCCTCAACGGCCTCTTTGTGCTTGGTCGCAGCATTGGTCTGATCGCTCACTATCTCGATCAAAAG
AGACTGCGAACTGGCCTGTATCGTCATCCCTGGGATGACATTACTTACCTTCTCCCCAACATGCGAGATGGACGG
CCTGGTGCCGAAGGAAGAGTAGAAGTTCAGATGTGA
Transcript >OphauG2|29
ATGGCTCAAGCTTCTTCAAGCGCCGCTGCTGGCGCAAAGGGCCAGTTGTCTGCAAACGACAACATCCAGCGCTTT
GCTGCGCCCAGTCGCCCTCTCAGCCCTTTGCCAGAGCACGCTCTCTTCAACGACAAGACGCGATGCTTCGTCTAC
GGCCTCCAGCCCCGCGCTGTCCAAGGCATGCTCGACTTCGACTTTATCTGCAAGCGTAAGACGCCTTCAGTCGCC
GGCATCGTCTATACCTTTGGTGGCCAGTTCGTCAGCAAGATGTACTGGGGCACCAGCGAGACCCTCCTGCCCGTG
TACCAGGAGGTCAGCAAGGCTATTAGCAAGCACCCCGACGTCGACGTAGTCGTCAACTTTGCTTCGTCGCGCAGC
GTCTACACCTCCACCATGGAGCTCATGGAGCATCCCCAAATCAAAACCATTGCCATCATTGCCGAGGGCGTCCCC
GAGCGACGAGCCCGTGAGATTGCCCATGTGGCCAAGAAGAAGGGCGTCACCATCATTGGCCCCGCCACTGTCGGT
GGCATCAAGCCCGGCAGCTTCAAGATCGGAAACACCGGTGGCATGATGGACAATATCGTCGCCTCCAAGCTGTAC
CGCAAGGGCTCCGTCGGCTACGTCTCCAAGTCTGGTGGCATGTCCAACGAACTCAACAACATCATTTCTCAGACG
ACTGACGGCGTGTACGAGGGCATTGCAATTGGTGGCGATCGATACCCTGGCACCACCTTCATCGACCATATGCTC
CGCTATCAGGCCGACCCCGAATGCAAAATCCTAGTCTTGCTCGGTGAGGTGGGCGGGGTAGAAGAATACAAGGTG
ATTGACGCTGTCAACAAGGGCATCATCACCAAGCCCATCGTTGCCTGGGCTATCGGTACCTGCGCCAGCATGTTC
AAGACCGAGGTCCAGTTCGGTCACGCTGGCTCCTTTGCCAACTCGCAACTTGAAACTGCTACAATGAAGAACAAG
ATGATGGCTGAGGCCGGCATCCACGTGCCCAAGACATTCGAGGACATGCCCTCGGTCCTCAAGAATGTCTATGAA
AAACTTGTCAAAGACGGCACCATCAAGCCGCAACCCGAGCCTGTCGTGCCCAAGATCCCTATTGACTATTCGTGG
GCTCAAGAGCTCGGCCTCATTCGAAAGCCAGCTGCCTTCATTTCAACCATATCCGACGACCGCGGCCAAGAACTT
CTTTACGCTGGCATGCCCATCTCGGATGTCTTCCGTGAGGAGATTGGCATCGGGGGCGTCATGTCATTGCTTTGG
TTCCGCCGCCGTCTACCAGACTACGCCTCCAAGTTTCTCGAAATGGTACTCATGCTTACCGCAGACCACGGCCCT
GCAGTATCTGGAGCCATGAACACCATCATCACCACGCGTGCCGGAAAAGACCTCATCAGTGCTCTTGTTTCTGGT
CTGTTGACGATTGGCTCCCGCTTTGGCGGTGCGCTGGATGGAGCCGCCGACGAGTTCACCAGAGCCTTTGACAAG
AACTTGAGCCCACGCGAATTTGTTGACACCATGCGAAAAGCCAACAAGCTCATACCCGGCATTGGCCACCGCATC
AAGTCGCGCAATAATCCTGACTTGCGTGTCGAACTCGTCAAAGAGTATGTCTTGGCAAAATTTCCTACCCATAAG
CTCCTCGACTACGCTCTGGCTGTTGAGACTGTCACAACGTCGAAAAAGGACAATCTCATTCTCAACGTGGATGGA
TGTATTGCCGTTTGTTTTGTGGATTTGCTACGCAATTGCGGTGCCTTTTCCCCAGAAGAGGCCGAGGACTATCTG
AAGATGGGCGTCCTCAACGGCCTCTTTGTGCTTGGTCGCAGCATTGGTCTGATCGCTCACTATCTCGATCAAAAG
AGACTGCGAACTGGCCTGTATCGTCATCCCTGGGATGACATTACTTACCTTCTCCCCAACATGCGAGATGGACGG
CCTGGTGCCGAAGGAAGAGTAGAAGTTCAGATGTGA
Gene >OphauG2|29
ATGGCTCAAGCTTCTTCAAGCGCCGCTGCTGGCGCAAAGGGCCAGTTGTCTGCAAACGACAACATCCAGCGCTTT
GCTGCGCCCAGTCGCCCTCTCAGCCCTTTGCCAGAGCACGCTCTCTTCAACGACAAGACGCGATGCTTCGTCTAC
GGCCTCCAGCCCCGCGCTGTCCAAGGCATGCTCGACTTCGACTTTATCTGCAAGCGTAAGACGCCTTCAGTCGCC
GGCATCGTCTATACCTTTGGTGGCCAGTTCGTCAGCAAGATGTACTGGGGCACCAGCGAGACCCTCCTGCCCGTG
TACCAGGAGGTCAGCAAGGCTATTAGCAAGCACCCCGACGTCGACGTAGTCGTCAACTTTGCTTCGTCGCGCAGC
GTCTACACCTCCACCATGGAGCTCATGGAGCATCCCCAAATCAAAACCATTGCCATCATTGCCGAGGGCGTCCCC
GAGCGAGTAAGTCTGTCCAAGACCACCAATTGACCGTGCTTGCCTGACCATGCACCCCTCTCAGCGAGCCCGTGA
GATTGCCCATGTGGCCAAGAAGAAGGGCGTCACCATCATTGGCCCCGCCACTGTCGGTGGCATCAAGCCCGGCAG
CTTCAAGATCGGAAACACCGGTGGCATGATGGACAATATCGTCGCCTCCAAGCTGTACCGCAAGGGCTCCGTCGG
CTACGTCTCCAAGTCTGGTGGCATGTCCAACGAACTCAACAACATCATTTCTCAGACGACTGACGGCGTGTACGA
GGGCATTGCAATTGGTGGCGATCGATACCCTGGCACCACCTTCATCGACCATATGCTCCGCTATCAGGCCGACCC
CGAATGCAAAATCCTAGTCTTGCTCGGTGAGGTGGGCGGGGTAGAAGAATACAAGGTGATTGACGCTGTCAACAA
GGGCATCATCACCAAGCCCATCGTTGCCTGGGCTATCGGTACCTGCGCCAGCATGTTCAAGACCGAGGTCCAGTT
CGGTCACGCTGGCTCCTTTGCCAACTCGCAACTTGAAACTGCTACAATGAAGAACAAGATGATGGCTGAGGCCGG
CATCCACGTGCCCAAGACATTCGAGGACATGCCCTCGGTCCTCAAGAATGTCTATGAAAAACTTGTCAAAGACGG
CACCATCAAGCCGCAACCCGAGCCTGTCGTGCCCAAGATCCCTATTGACTATTCGTGGGCTCAAGAGCTCGGCCT
CATTCGAAAGCCAGCTGCCTTCATTTCAACCATATCCGACGACCGCGGCCAAGAACTTCTTTACGCTGGCATGCC
CATCTCGGATGTCTTCCGTGAGGAGATTGGCATCGGGGGCGTCATGTCATTGCTTTGGTTCCGCCGCCGTCTACC
AGACTACGCCTCCAAGTTTCTCGAAATGGTACTCATGCTTACCGCAGACCACGGCCCTGCAGTATCTGGAGCCAT
GAACACCATCATCACCACGCGTGCCGGAAAAGACCTCATCAGTGCTCTTGTTTCTGGTCTGTTGACGATTGGCTC
CCGCTTTGGCGGTGCGCTGGATGGAGCCGCCGACGAGTTCACCAGAGCCTTTGACAAGAACTTGAGCCCACGCGA
ATTTGTTGACACCATGCGAAAAGCCAACAAGCTCATACCCGGCATTGGCCACCGCATCAAGTCGCGCAATAATCC
TGACTTGCGTGTCGAACTCGTCAAAGAGTATGTCTTGGCAAAATTTCCTACCCATAAGCTCCTCGACTACGCTCT
GGCTGTTGAGACTGTCACAACGTCGAAAAAGGACAATCTCATTCTCAACGTGGATGGATGTATTGCCGTTTGTTT
TGTGGATTTGCTACGCAATTGCGGTGCCTTTTCCCCAGAAGAGGCCGAGGACTATCTGAAGATGGGCGTCCTCAA
CGGCCTCTTTGTGCTTGGTCGCAGCATTGGTCTGATCGCTCACTATCTCGATCAAAAGAGACTGCGAACTGGCCT
GTATCGTCATCCCTGGGATGACATTACTTACCTTCTCCCCAACATGCGAGATGGACGGCCTGGTGCCGAAGGAAG
AGTAGAAGTTCAGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail