Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2898
Gene name
LocationContig_212:19580..20067
Strand+
Gene length (bp)487
Transcript length (bp)345
Coding sequence length (bp)345
Protein length (aa) 115

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01172 SBDS Shwachman-Bodian-Diamond syndrome (SBDS) protein 2.0E-23 8 97

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7K6|SDO1L_SCHPO SDO1-like protein C21C3.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.19 PE=3 SV=1 1 101 2.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4520
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2898 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3041
Ophiocordyceps camponoti-floridani Ophcf2|04409
Ophiocordyceps camponoti-rufipedis Ophun1|5288
Ophiocordyceps kimflemingae Ophio5|3140
Ophiocordyceps subramaniannii Hirsu2|9442

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2898
MTRGETTQSKIHYKGKTDDFLVFVDDEATYKKWLCDRSVPLAHFISSFKIFCTHKQGAQGTFDTASKSALAAEFE
MEDEDEVIKTILQKGSMQTMEMPSRQGATNDSMGPMKAH*
Coding >OphauG2|2898
ATGACTCGAGGAGAAACCACGCAGTCCAAGATTCACTACAAGGGCAAGACGGACGATTTTCTCGTCTTTGTCGAC
GATGAGGCGACGTACAAGAAGTGGTTGTGCGACAGGAGCGTGCCTCTTGCTCATTTCATTTCGTCGTTTAAAATC
TTCTGCACCCACAAACAAGGCGCCCAGGGGACATTTGACACGGCGTCCAAAAGCGCTCTCGCCGCCGAGTTTGAG
ATGGAGGACGAAGACGAGGTCATCAAGACCATCTTGCAAAAGGGCTCGATGCAGACAATGGAGATGCCTAGCCGA
CAAGGCGCCACAAACGACTCTATGGGTCCCATGAAGGCACACTAA
Transcript >OphauG2|2898
ATGACTCGAGGAGAAACCACGCAGTCCAAGATTCACTACAAGGGCAAGACGGACGATTTTCTCGTCTTTGTCGAC
GATGAGGCGACGTACAAGAAGTGGTTGTGCGACAGGAGCGTGCCTCTTGCTCATTTCATTTCGTCGTTTAAAATC
TTCTGCACCCACAAACAAGGCGCCCAGGGGACATTTGACACGGCGTCCAAAAGCGCTCTCGCCGCCGAGTTTGAG
ATGGAGGACGAAGACGAGGTCATCAAGACCATCTTGCAAAAGGGCTCGATGCAGACAATGGAGATGCCTAGCCGA
CAAGGCGCCACAAACGACTCTATGGGTCCCATGAAGGCACACTAA
Gene >OphauG2|2898
ATGACTCGAGGAGAAACCACGCAGTCCAAGATTCACTACAAGGGCAAGACGGACGATTTTCTCGTCTTTGTCGAC
GATGAGGCGACGTACAAGAAGTGGTTGTGCGACAGGAGCGTGCCTCTTGCTCATTTCATTTCGTCGTTTAAAATC
TTCTGCACCCACAAGTAAGCGTCCTTGGCCGAGACGCCATAAGACGCTCGCGGCTGCGTCTGGGCTGACTCAAGC
ATGACTGGCACTAGACAAGGCGCCCAGGGGACATTTGACACGGCGTCCAAAAGCGCTCTCGCCGCCGAGTTTGAG
ATGGAGGACGAAGACGAGGTCATCAAGACCATCTTGCAAAAGGGCTCGATGCAGACAATGGAGGTAATGAGACCA
CCACGCTATCTCACAGGCAAATGTTTGCCTCTTCTGACATGATTGCTCGATGCAGATGCCTAGCCGACAAGGCGC
CACAAACGACTCTATGGGTCCCATGAAGGCACACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail