Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2894
Gene name
LocationContig_212:7697..9269
Strand-
Gene length (bp)1572
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11470 TUG-UBL1 TUG ubiquitin-like domain 2.9E-24 8 71

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8VBT9|ASPC1_MOUSE Tether containing UBX domain for GLUT4 OS=Mus musculus GN=Aspscr1 PE=1 SV=1 5 190 3.0E-09
sp|Q9BZE9|ASPC1_HUMAN Tether containing UBX domain for GLUT4 OS=Homo sapiens GN=ASPSCR1 PE=1 SV=1 5 117 1.0E-08
sp|P54730|UBX4_YEAST UBX domain-containing protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX4 PE=1 SV=1 5 393 1.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4523
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2894 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3036
Ophiocordyceps camponoti-floridani Ophcf2|04413
Ophiocordyceps camponoti-rufipedis Ophun1|761
Ophiocordyceps kimflemingae Ophio5|3144
Ophiocordyceps subramaniannii Hirsu2|9447

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2894
MSSHVVVIATDLRRTTIKVSPGTYLVDVLDEACKKLKLSNDKYLIKHKQKNVDLSIPFRTSGLIPGARLELVQKA
NTPSAIQIALQVPQPEAKEIPGGRLIRRFPSDLALWKVLRQFESGEASAGKNINITARAIAATNGSGSGQLYYEM
PVLNVMGRELSTFDDFHKTLSQLGHNSGNVLIRLAFRKTDQTLSEAMAHISNLFREPQVQEAAEPESSNVLSQRQ
QKKHVVAADATTKLQSSSSQDEPHPNLTLEEPSNKQDAAPITDAQSPPHENRYQPVNVFLAPGSDVPAAVRAPVD
DDADFIPTIAHAQLHQARLQKSARNTRLLSDEEIEQKEAAEEARIASIKSILVKVRFPDNTSSDWQIGPDDTGAF
LYEAVRHVMAHCDQPFRLLLPRIKAAIRDDNSSSNRLIKAYKLSSRVLVSLVWDDVVPADVRRQPFLKTRIAQQG
LEIRVPEIPMTPAPEATDEVTPQFAQRSRSEGLGDVGSKKIPKWFKFGKK*
Coding >OphauG2|2894
ATGTCTTCGCATGTCGTCGTCATTGCCACAGACTTGCGCCGCACTACGATAAAGGTCTCTCCAGGAACCTACCTC
GTCGACGTCCTTGACGAAGCGTGCAAAAAGCTCAAGCTCTCCAATGACAAATACCTCATCAAACACAAACAAAAG
AACGTTGACCTGTCGATACCCTTTCGTACCTCTGGCCTGATACCCGGTGCTAGGCTCGAACTTGTTCAAAAGGCA
AATACGCCCTCGGCCATCCAAATCGCCCTGCAAGTTCCTCAGCCTGAAGCAAAAGAAATACCAGGTGGGCGTCTG
ATTCGCAGATTCCCGTCCGACCTGGCCTTATGGAAGGTGCTTCGACAATTCGAGAGCGGCGAGGCAAGTGCCGGT
AAGAACATCAATATTACTGCCAGAGCTATTGCCGCTACAAATGGGTCCGGAAGCGGACAGCTCTACTATGAGATG
CCCGTCCTCAACGTCATGGGCAGGGAATTGTCAACCTTTGACGACTTTCATAAAACACTGTCGCAGCTGGGTCAT
AATTCTGGAAATGTCCTCATCAGGCTGGCGTTCAGAAAGACGGACCAGACTCTTTCTGAAGCAATGGCGCACATC
AGCAATTTGTTTCGGGAACCTCAAGTTCAAGAAGCCGCCGAACCCGAAAGTAGCAATGTCCTTAGCCAAAGGCAG
CAAAAAAAGCATGTGGTTGCGGCGGACGCGACCACAAAGCTTCAGTCATCCTCTTCACAAGACGAGCCACACCCA
AATTTGACATTAGAAGAACCGTCCAACAAGCAAGACGCCGCCCCAATAACTGATGCACAAAGTCCACCGCATGAA
AATCGCTATCAACCTGTCAACGTCTTCCTTGCCCCTGGAAGTGACGTGCCCGCTGCTGTCCGTGCCCCAGTCGAC
GATGATGCGGATTTTATTCCGACCATAGCACACGCACAGCTTCATCAGGCCCGCCTGCAAAAATCGGCCCGCAAC
ACGCGTCTTCTCTCTGACGAGGAAATTGAGCAGAAGGAAGCAGCTGAAGAAGCCCGTATAGCCTCCATAAAGTCG
ATTCTAGTCAAGGTGCGATTTCCAGATAATACAAGCAGCGACTGGCAAATCGGCCCAGATGACACTGGCGCCTTT
CTTTATGAGGCTGTCAGGCACGTCATGGCTCACTGCGACCAACCCTTTCGTCTGCTTCTCCCTAGGATCAAGGCA
GCTATTCGTGACGACAACAGTTCCAGTAATAGACTTATTAAGGCCTACAAGTTGTCAAGTCGTGTTCTTGTCAGC
CTAGTATGGGACGACGTCGTGCCGGCCGACGTGCGCCGCCAACCATTTCTCAAAACCCGCATCGCGCAACAAGGG
CTGGAAATCAGGGTTCCAGAGATTCCAATGACACCAGCACCAGAGGCTACAGATGAAGTCACTCCTCAATTTGCA
CAAAGGTCAAGAAGCGAGGGTCTAGGAGACGTTGGATCCAAGAAAATACCCAAGTGGTTCAAATTTGGCAAGAAA
TGA
Transcript >OphauG2|2894
ATGTCTTCGCATGTCGTCGTCATTGCCACAGACTTGCGCCGCACTACGATAAAGGTCTCTCCAGGAACCTACCTC
GTCGACGTCCTTGACGAAGCGTGCAAAAAGCTCAAGCTCTCCAATGACAAATACCTCATCAAACACAAACAAAAG
AACGTTGACCTGTCGATACCCTTTCGTACCTCTGGCCTGATACCCGGTGCTAGGCTCGAACTTGTTCAAAAGGCA
AATACGCCCTCGGCCATCCAAATCGCCCTGCAAGTTCCTCAGCCTGAAGCAAAAGAAATACCAGGTGGGCGTCTG
ATTCGCAGATTCCCGTCCGACCTGGCCTTATGGAAGGTGCTTCGACAATTCGAGAGCGGCGAGGCAAGTGCCGGT
AAGAACATCAATATTACTGCCAGAGCTATTGCCGCTACAAATGGGTCCGGAAGCGGACAGCTCTACTATGAGATG
CCCGTCCTCAACGTCATGGGCAGGGAATTGTCAACCTTTGACGACTTTCATAAAACACTGTCGCAGCTGGGTCAT
AATTCTGGAAATGTCCTCATCAGGCTGGCGTTCAGAAAGACGGACCAGACTCTTTCTGAAGCAATGGCGCACATC
AGCAATTTGTTTCGGGAACCTCAAGTTCAAGAAGCCGCCGAACCCGAAAGTAGCAATGTCCTTAGCCAAAGGCAG
CAAAAAAAGCATGTGGTTGCGGCGGACGCGACCACAAAGCTTCAGTCATCCTCTTCACAAGACGAGCCACACCCA
AATTTGACATTAGAAGAACCGTCCAACAAGCAAGACGCCGCCCCAATAACTGATGCACAAAGTCCACCGCATGAA
AATCGCTATCAACCTGTCAACGTCTTCCTTGCCCCTGGAAGTGACGTGCCCGCTGCTGTCCGTGCCCCAGTCGAC
GATGATGCGGATTTTATTCCGACCATAGCACACGCACAGCTTCATCAGGCCCGCCTGCAAAAATCGGCCCGCAAC
ACGCGTCTTCTCTCTGACGAGGAAATTGAGCAGAAGGAAGCAGCTGAAGAAGCCCGTATAGCCTCCATAAAGTCG
ATTCTAGTCAAGGTGCGATTTCCAGATAATACAAGCAGCGACTGGCAAATCGGCCCAGATGACACTGGCGCCTTT
CTTTATGAGGCTGTCAGGCACGTCATGGCTCACTGCGACCAACCCTTTCGTCTGCTTCTCCCTAGGATCAAGGCA
GCTATTCGTGACGACAACAGTTCCAGTAATAGACTTATTAAGGCCTACAAGTTGTCAAGTCGTGTTCTTGTCAGC
CTAGTATGGGACGACGTCGTGCCGGCCGACGTGCGCCGCCAACCATTTCTCAAAACCCGCATCGCGCAACAAGGG
CTGGAAATCAGGGTTCCAGAGATTCCAATGACACCAGCACCAGAGGCTACAGATGAAGTCACTCCTCAATTTGCA
CAAAGGTCAAGAAGCGAGGGTCTAGGAGACGTTGGATCCAAGAAAATACCCAAGTGGTTCAAATTTGGCAAGAAA
TGA
Gene >OphauG2|2894
ATGTCTTCGCATGTCGTCGTCATTGCCACAGACTTGCGCCGCACTACGATAAAGGTCTCTCCAGGAACCTACCTC
GTCGACGTCCTTGACGAAGCGTGCAAAAAGCTCAAGCTCTCCAATGACAAATACCTCATCAAGTCAGTCAGCTAC
AGTCGTCTTGCTTTACCCGCCCTGTGCCATACCTGACTGACTTGATCATCGACCAGACACAAACAAAAGAACGTT
GACCTGTCGATACCCTTTCGTACCTCTGGCCTGATACCCGGTGCTAGGCTCGAACTTGTTCAAAAGGCAAATACG
CCCTCGGCCATCCAAATCGCCCTGCAAGTTCCTCAGCCTGAAGCAAAAGAAATACCAGGTGGGCGTCTGATTCGC
AGATTCCCGTCCGACCTGGCCTTATGGAAGGTGCTTCGACAATTCGAGAGCGGCGAGGCAAGTGCCGGTAAGAAC
ATCAATATTACTGCCAGAGCTATTGCCGCTACAAATGGGTCCGGAAGCGGACAGCTCTACTATGAGATGCCCGTC
CTCAACGTCATGGGCAGGGAATTGTCAACCTTTGACGACTTTCATAAAACACTGTCGCAGCTGGGTCATAATTCT
GGAAATGTCCTCATCAGGCTGGCGTTCAGAAAGACGGACCAGACTCTTTCTGAAGCAATGGCGCACATCAGCAAT
TTGTTTCGGGAACCTCAAGTTCAAGAAGCCGCCGAACCCGAAAGTAGCAATGTCCTTAGCCAAAGGCAGCAAAAA
AAGCATGTGGTTGCGGCGGACGCGACCACAAAGCTTCAGTCATCCTCTTCACAAGACGAGCCACACCCAAATTTG
ACATTAGAAGAACCGTCCAACAAGCAAGACGCCGCCCCAATAACTGATGCACAAAGTCCACCGCATGAAAATCGC
TATCAACCTGTCAACGTCTTCCTTGCCCCTGGAAGTGACGTGCCCGCTGCTGTCCGTGCCCCAGTCGACGATGAT
GCGGATTTTATTCCGACCATAGCACACGCACAGCTTCATCAGGCCCGCCTGCAAAAATCGGCCCGCAACACGCGT
CTTCTCTCTGACGAGGAAATTGAGCAGAAGGAAGCAGCTGAAGAAGCCCGTATAGCCTCCATAAAGTCGATTCTA
GTCAAGGTGCGATTTCCAGATAATACAAGCAGCGACTGGCAAATCGGCCCAGATGACACTGGCGCCTTTCTTTAT
GAGGCTGTCAGGCACGTCATGGCTCACTGCGACCAACCCTTTCGTCTGCTTCTCCCTAGGATCAAGGCAGCTATT
CGTGACGACAACAGTTCCAGTAATAGACTTATTAAGGCCTACAAGTTGTCAAGTCGTGTTCTTGTCAGCCTAGTA
TGGGACGACGTCGTGCCGGCCGACGTGCGCCGCCAACCATTTCTCAAAACCCGCATCGCGCAACAAGGGCTGGAA
ATCAGGGTTCCAGAGATTCCAATGACACCAGCACCAGAGGCTACAGATGAAGTCACTCCTCAATTTGCACAAAGG
TCAAGAAGCGAGGGTCTAGGAGACGTTGGATCCAAGAAAATACCCAAGTGGTTCAAATTTGGCAAGAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail