Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|289
Gene name
LocationContig_1060:2256..5882
Strand-
Gene length (bp)3626
Transcript length (bp)3255
Coding sequence length (bp)3255
Protein length (aa) 1085

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03983 SHD1 SLA1 homology domain 1, SHD1 1.9E-33 499 564
PF00018 SH3_1 SH3 domain 3.7E-06 8 60
PF00018 SH3_1 SH3 domain 7.6E-06 76 119
PF00018 SH3_1 SH3 domain 4.4E-13 384 431
PF14604 SH3_9 Variant SH3 domain 3.7E-11 384 435
PF07653 SH3_2 Variant SH3 domain 5.7E-06 383 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7E8B6|SLA1_SCLS1 Actin cytoskeleton-regulatory complex protein sla1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sla1 PE=3 SV=2 1 1084 0.0E+00
sp|Q6CHN0|SLA1_YARLI Actin cytoskeleton-regulatory complex protein SLA1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SLA1 PE=3 SV=1 283 694 4.0E-94
sp|Q5ALV2|SLA1_CANAL Actin cytoskeleton-regulatory complex protein SLA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLA1 PE=1 SV=1 266 807 5.0E-90
sp|A7TKW4|SLA1_VANPO Actin cytoskeleton-regulatory complex protein SLA1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SLA1 PE=3 SV=1 2 568 2.0E-82
sp|A6ZKU1|SLA1_YEAS7 Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SLA1 PE=3 SV=1 268 568 4.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7E8B6|SLA1_SCLS1 Actin cytoskeleton-regulatory complex protein sla1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sla1 PE=3 SV=2 1 1084 0.0E+00
sp|Q6CHN0|SLA1_YARLI Actin cytoskeleton-regulatory complex protein SLA1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SLA1 PE=3 SV=1 283 694 4.0E-94
sp|Q5ALV2|SLA1_CANAL Actin cytoskeleton-regulatory complex protein SLA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLA1 PE=1 SV=1 266 807 5.0E-90
sp|A7TKW4|SLA1_VANPO Actin cytoskeleton-regulatory complex protein SLA1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SLA1 PE=3 SV=1 2 568 2.0E-82
sp|A6ZKU1|SLA1_YEAS7 Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SLA1 PE=3 SV=1 268 568 4.0E-52
sp|P32790|SLA1_YEAST Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLA1 PE=1 SV=1 268 568 5.0E-52
sp|Q4P3H6|SLA1_USTMA Actin cytoskeleton-regulatory complex protein SLA1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SLA1 PE=3 SV=1 495 749 4.0E-42
sp|O13736|SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sla1 PE=1 SV=1 271 581 5.0E-37
sp|A6ZKU1|SLA1_YEAS7 Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SLA1 PE=3 SV=1 598 801 6.0E-25
sp|P32790|SLA1_YEAST Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLA1 PE=1 SV=1 598 801 7.0E-25
sp|A7TKW4|SLA1_VANPO Actin cytoskeleton-regulatory complex protein SLA1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SLA1 PE=3 SV=1 591 805 4.0E-24
sp|A6ZKU1|SLA1_YEAS7 Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SLA1 PE=3 SV=1 2 123 5.0E-22
sp|P32790|SLA1_YEAST Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLA1 PE=1 SV=1 2 123 6.0E-22
sp|O13736|SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sla1 PE=1 SV=1 599 1046 7.0E-20
sp|O13736|SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sla1 PE=1 SV=1 3 123 5.0E-18
sp|Q4P3H6|SLA1_USTMA Actin cytoskeleton-regulatory complex protein SLA1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SLA1 PE=3 SV=1 1 129 3.0E-15
sp|Q4P3H6|SLA1_USTMA Actin cytoskeleton-regulatory complex protein SLA1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SLA1 PE=3 SV=1 377 435 6.0E-09
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 6 124 2.0E-08
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 21 124 3.0E-08
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 21 124 4.0E-08
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 21 124 2.0E-07
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 40 123 2.0E-06
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 21 124 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0043130 ubiquitin binding Yes
GO:0030674 protein-macromolecule adaptor activity Yes
GO:0008092 cytoskeletal protein binding Yes
GO:0042802 identical protein binding Yes
GO:0003674 molecular_function No
GO:0060090 molecular adaptor activity No
GO:0005488 binding No
GO:0032182 ubiquitin-like protein binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1898
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|289 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4733
Ophiocordyceps camponoti-floridani Ophcf2|01788
Ophiocordyceps camponoti-rufipedis Ophun1|3254
Ophiocordyceps kimflemingae Ophio5|8313
Ophiocordyceps subramaniannii Hirsu2|1976

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|289
MVFLGVYKALYPWTESDDGMLPMEQGDLLCIVGMNEGSDWWRAKKKAVADEDDEPEGFVPSNYIEPAPVLGHAHT
IYEYTRQTDEELSFSEDVVLQIFDTSDPDWILAGLDGDFGFVPSNYIEMQAIVTDEVTPPPSPDAPPILPARPQS
VITEAERERKPEAEPEQQKEVRSPKSGSRGPAGALAGVLQSRQNSVQTLRQPHHERSVSARDDDYENDNGSLSSP
ALPDRPQPSVDNGSNSREARPCNQPNSHNPQPGEEPLRTPGGFHMYNISEMVSVMGKRKKMPTTLGINLKTGTIL
IAPEHAQDDPPQEWTSDKMRHYSREGKHVFLELVRPSKSIDFHAGARDTAEEIMGALSDLAGVLRAEGLREAILS
VDSVRKGQVLYDFMAQGDDEVTVAAGDQVLVLDNSKSDEWWQVRRVKNGRQGVVPSSYIELTKTSSPTPTPGVSQ
STINSARSTVEQNRLEEIRLTKAAIKANREPQQQQRSRRGSSRSDSRSKAKPDSAKVRAWTDRSGAFSVDAQFLG
LRDGKIHLHKLNGVKIAVPIAKMSQADLEYVEQTTGMSLDDDKPLADVKRAKSTTKSAKVGATVGRSDKVEPEYD
WFQFFLSCDVAVGLCERYAQAFTRDSMDESVLPDVNVSVLRTLGLREGDILKVMRHLDAKFNRDRSSTARAEDDN
AAGGLFSGPGGALRNNTRKGRPAPTVQTNDVVDAAALSASSVAKNGSMELAVSPVKASAGGFDDDAWEVKTPQSS
SSESKRQQNQPVYSGALKPQASTMVAETPLIGSMKDLSLLTQPLQPTKVEAQPTAVSLGSSQGPVEQGQQPLQQL
AGASPSFFSSMPPLPTTSPQSLQPLARNRPPPPLSSGMSPGLGSLPPPPPTQRSLPAPQSAQQTVFSAATMTPQM
TSSLQSQVAPPGQSLNDLSNARMQQQYAVQMQQMQPVVSGYGGMQPQSIIGFPTGQPMMQQPMMTGMSGASPFAD
PVRQSQFSPVQAQPTGFQQSQFPQAMAMPSYGMQHSQATGAINNFLPPALEPQRTGAPPLIPQPLLPQRTGPPPP
VRFGMPAEAKKLASQQTGRRANLAQATPDNPFGF*
Coding >OphauG2|289
ATGGTGTTTCTGGGCGTGTATAAGGCTCTTTACCCCTGGACCGAAAGCGACGATGGCATGCTTCCCATGGAACAA
GGCGACCTCCTATGCATCGTGGGCATGAATGAAGGCAGCGACTGGTGGAGAGCGAAGAAGAAGGCAGTGGCCGAT
GAGGACGATGAGCCCGAGGGCTTCGTACCGAGCAACTATATCGAACCGGCCCCCGTACTGGGACACGCTCATACT
ATCTACGAGTACACGCGCCAGACAGATGAAGAGCTATCTTTTTCGGAAGACGTTGTGCTGCAAATTTTTGACACG
TCGGACCCCGATTGGATTCTCGCCGGTCTCGATGGAGACTTTGGCTTCGTGCCATCGAACTACATTGAGATGCAG
GCAATAGTCACAGACGAAGTCACCCCCCCACCATCCCCCGACGCTCCACCAATTTTGCCTGCAAGACCACAATCA
GTCATTACTGAAGCGGAACGGGAGCGGAAGCCGGAAGCGGAGCCGGAACAACAAAAAGAGGTTAGGTCTCCAAAA
TCAGGGTCAAGAGGCCCGGCCGGTGCCCTGGCTGGTGTTTTGCAAAGCCGCCAAAATTCCGTGCAAACTTTGCGG
CAACCTCATCACGAGCGTTCAGTATCAGCACGAGATGACGATTACGAGAATGATAACGGGTCCCTGTCTTCACCA
GCGCTGCCGGATCGTCCACAACCTAGCGTTGACAATGGCTCAAACAGTCGTGAAGCCAGACCTTGTAACCAGCCC
AACAGCCATAACCCTCAACCTGGCGAGGAACCATTGAGAACACCAGGGGGGTTTCACATGTACAATATCAGCGAG
ATGGTGTCAGTGATGGGCAAGAGGAAAAAGATGCCGACGACTCTGGGCATCAATCTCAAAACAGGCACCATACTC
ATTGCCCCCGAACACGCTCAAGACGACCCCCCGCAGGAGTGGACAAGCGATAAGATGAGACACTATTCTCGTGAA
GGCAAGCACGTGTTTCTTGAACTTGTCCGTCCTAGCAAGAGTATCGACTTTCATGCCGGGGCTAGAGATACTGCT
GAAGAGATAATGGGGGCCCTGAGCGACCTTGCTGGTGTCCTCCGGGCTGAGGGCCTACGAGAGGCTATATTATCA
GTCGATAGCGTCCGCAAAGGTCAAGTCCTGTACGACTTTATGGCACAGGGTGACGACGAAGTGACAGTAGCAGCT
GGAGACCAAGTTTTGGTGTTGGATAATTCCAAGAGCGACGAGTGGTGGCAGGTCAGGCGTGTCAAGAACGGCAGA
CAGGGAGTTGTTCCCAGCAGCTACATAGAGTTGACGAAAACATCATCACCAACACCCACGCCTGGGGTTAGCCAG
TCGACCATAAATTCGGCCAGATCTACGGTTGAGCAGAATCGGCTCGAAGAGATACGGCTTACCAAGGCGGCCATC
AAGGCAAATAGAGAGCCACAGCAGCAGCAGAGGAGCCGGCGCGGAAGCAGTCGAAGCGACTCCAGATCCAAAGCT
AAACCGGATTCGGCCAAGGTGAGGGCATGGACAGATCGCTCAGGAGCCTTCAGCGTCGATGCGCAGTTTCTTGGT
CTTCGGGACGGCAAGATTCACTTGCATAAGCTCAATGGTGTGAAGATTGCCGTTCCCATTGCCAAGATGTCACAG
GCCGATCTTGAGTACGTGGAGCAGACTACGGGCATGTCGCTCGACGACGACAAGCCCCTGGCTGATGTAAAGCGA
GCCAAGTCGACGACAAAGTCGGCTAAGGTTGGTGCAACAGTGGGAAGAAGTGATAAGGTAGAACCAGAGTACGAC
TGGTTTCAGTTTTTTCTCAGCTGTGACGTGGCAGTTGGCCTGTGTGAGCGCTATGCTCAGGCCTTTACCCGAGAC
TCGATGGACGAGAGTGTACTCCCAGACGTCAATGTCTCGGTCCTACGAACCTTAGGTCTCCGCGAGGGTGACATT
CTCAAGGTGATGCGCCATCTCGACGCCAAGTTCAACCGTGACCGAAGCAGCACCGCCAGGGCTGAAGATGACAAT
GCTGCCGGTGGTCTCTTCTCTGGACCCGGCGGCGCCCTACGCAACAACACGCGCAAGGGCCGTCCGGCGCCTACT
GTGCAAACAAATGATGTTGTCGATGCTGCTGCTCTTTCGGCCTCGAGCGTCGCCAAGAATGGATCCATGGAACTG
GCGGTGAGTCCAGTCAAGGCTTCGGCCGGTGGATTTGATGATGATGCGTGGGAAGTCAAAACGCCGCAATCTAGT
AGTAGCGAGAGCAAACGCCAGCAAAATCAGCCTGTATATTCCGGGGCCCTCAAGCCTCAAGCTTCGACCATGGTT
GCTGAAACACCTCTCATCGGCTCCATGAAGGATCTTTCACTCCTAACGCAGCCGCTGCAACCCACCAAGGTTGAG
GCGCAGCCAACAGCCGTGAGCCTTGGCTCAAGTCAAGGCCCTGTCGAGCAAGGACAGCAGCCGTTGCAGCAGCTC
GCTGGGGCCAGTCCGTCCTTCTTTTCATCCATGCCTCCGCTGCCAACAACATCTCCCCAGTCCCTCCAACCCCTG
GCCCGGAACCGACCCCCCCCTCCTCTATCCTCTGGCATGTCACCTGGCTTGGGGTCCCTCCCGCCGCCGCCGCCG
ACGCAGCGGTCGCTTCCTGCTCCACAGTCGGCACAGCAAACCGTCTTCTCCGCGGCAACGATGACTCCGCAGATG
ACTAGTTCCTTGCAGTCGCAAGTGGCTCCTCCTGGTCAAAGCCTCAACGACCTCAGCAATGCCAGAATGCAACAG
CAATACGCGGTACAGATGCAGCAGATGCAGCCTGTTGTGTCGGGATATGGCGGCATGCAGCCTCAATCCATAATA
GGTTTCCCCACGGGCCAGCCCATGATGCAGCAGCCCATGATGACAGGAATGTCGGGTGCCAGTCCCTTTGCCGAT
CCCGTTCGTCAAAGCCAGTTCTCACCTGTTCAGGCACAGCCAACAGGCTTCCAACAGTCTCAGTTCCCCCAAGCA
ATGGCCATGCCTTCATATGGGATGCAACATAGTCAGGCCACCGGAGCCATCAATAACTTCCTACCTCCAGCGCTA
GAGCCACAACGAACTGGGGCTCCTCCACTCATTCCGCAGCCACTGCTGCCGCAAAGGACGGGGCCACCGCCACCA
GTACGGTTTGGCATGCCGGCCGAGGCCAAGAAACTGGCGTCGCAGCAAACTGGGCGAAGGGCAAACTTGGCTCAA
GCTACCCCAGATAATCCATTCGGGTTTTGA
Transcript >OphauG2|289
ATGGTGTTTCTGGGCGTGTATAAGGCTCTTTACCCCTGGACCGAAAGCGACGATGGCATGCTTCCCATGGAACAA
GGCGACCTCCTATGCATCGTGGGCATGAATGAAGGCAGCGACTGGTGGAGAGCGAAGAAGAAGGCAGTGGCCGAT
GAGGACGATGAGCCCGAGGGCTTCGTACCGAGCAACTATATCGAACCGGCCCCCGTACTGGGACACGCTCATACT
ATCTACGAGTACACGCGCCAGACAGATGAAGAGCTATCTTTTTCGGAAGACGTTGTGCTGCAAATTTTTGACACG
TCGGACCCCGATTGGATTCTCGCCGGTCTCGATGGAGACTTTGGCTTCGTGCCATCGAACTACATTGAGATGCAG
GCAATAGTCACAGACGAAGTCACCCCCCCACCATCCCCCGACGCTCCACCAATTTTGCCTGCAAGACCACAATCA
GTCATTACTGAAGCGGAACGGGAGCGGAAGCCGGAAGCGGAGCCGGAACAACAAAAAGAGGTTAGGTCTCCAAAA
TCAGGGTCAAGAGGCCCGGCCGGTGCCCTGGCTGGTGTTTTGCAAAGCCGCCAAAATTCCGTGCAAACTTTGCGG
CAACCTCATCACGAGCGTTCAGTATCAGCACGAGATGACGATTACGAGAATGATAACGGGTCCCTGTCTTCACCA
GCGCTGCCGGATCGTCCACAACCTAGCGTTGACAATGGCTCAAACAGTCGTGAAGCCAGACCTTGTAACCAGCCC
AACAGCCATAACCCTCAACCTGGCGAGGAACCATTGAGAACACCAGGGGGGTTTCACATGTACAATATCAGCGAG
ATGGTGTCAGTGATGGGCAAGAGGAAAAAGATGCCGACGACTCTGGGCATCAATCTCAAAACAGGCACCATACTC
ATTGCCCCCGAACACGCTCAAGACGACCCCCCGCAGGAGTGGACAAGCGATAAGATGAGACACTATTCTCGTGAA
GGCAAGCACGTGTTTCTTGAACTTGTCCGTCCTAGCAAGAGTATCGACTTTCATGCCGGGGCTAGAGATACTGCT
GAAGAGATAATGGGGGCCCTGAGCGACCTTGCTGGTGTCCTCCGGGCTGAGGGCCTACGAGAGGCTATATTATCA
GTCGATAGCGTCCGCAAAGGTCAAGTCCTGTACGACTTTATGGCACAGGGTGACGACGAAGTGACAGTAGCAGCT
GGAGACCAAGTTTTGGTGTTGGATAATTCCAAGAGCGACGAGTGGTGGCAGGTCAGGCGTGTCAAGAACGGCAGA
CAGGGAGTTGTTCCCAGCAGCTACATAGAGTTGACGAAAACATCATCACCAACACCCACGCCTGGGGTTAGCCAG
TCGACCATAAATTCGGCCAGATCTACGGTTGAGCAGAATCGGCTCGAAGAGATACGGCTTACCAAGGCGGCCATC
AAGGCAAATAGAGAGCCACAGCAGCAGCAGAGGAGCCGGCGCGGAAGCAGTCGAAGCGACTCCAGATCCAAAGCT
AAACCGGATTCGGCCAAGGTGAGGGCATGGACAGATCGCTCAGGAGCCTTCAGCGTCGATGCGCAGTTTCTTGGT
CTTCGGGACGGCAAGATTCACTTGCATAAGCTCAATGGTGTGAAGATTGCCGTTCCCATTGCCAAGATGTCACAG
GCCGATCTTGAGTACGTGGAGCAGACTACGGGCATGTCGCTCGACGACGACAAGCCCCTGGCTGATGTAAAGCGA
GCCAAGTCGACGACAAAGTCGGCTAAGGTTGGTGCAACAGTGGGAAGAAGTGATAAGGTAGAACCAGAGTACGAC
TGGTTTCAGTTTTTTCTCAGCTGTGACGTGGCAGTTGGCCTGTGTGAGCGCTATGCTCAGGCCTTTACCCGAGAC
TCGATGGACGAGAGTGTACTCCCAGACGTCAATGTCTCGGTCCTACGAACCTTAGGTCTCCGCGAGGGTGACATT
CTCAAGGTGATGCGCCATCTCGACGCCAAGTTCAACCGTGACCGAAGCAGCACCGCCAGGGCTGAAGATGACAAT
GCTGCCGGTGGTCTCTTCTCTGGACCCGGCGGCGCCCTACGCAACAACACGCGCAAGGGCCGTCCGGCGCCTACT
GTGCAAACAAATGATGTTGTCGATGCTGCTGCTCTTTCGGCCTCGAGCGTCGCCAAGAATGGATCCATGGAACTG
GCGGTGAGTCCAGTCAAGGCTTCGGCCGGTGGATTTGATGATGATGCGTGGGAAGTCAAAACGCCGCAATCTAGT
AGTAGCGAGAGCAAACGCCAGCAAAATCAGCCTGTATATTCCGGGGCCCTCAAGCCTCAAGCTTCGACCATGGTT
GCTGAAACACCTCTCATCGGCTCCATGAAGGATCTTTCACTCCTAACGCAGCCGCTGCAACCCACCAAGGTTGAG
GCGCAGCCAACAGCCGTGAGCCTTGGCTCAAGTCAAGGCCCTGTCGAGCAAGGACAGCAGCCGTTGCAGCAGCTC
GCTGGGGCCAGTCCGTCCTTCTTTTCATCCATGCCTCCGCTGCCAACAACATCTCCCCAGTCCCTCCAACCCCTG
GCCCGGAACCGACCCCCCCCTCCTCTATCCTCTGGCATGTCACCTGGCTTGGGGTCCCTCCCGCCGCCGCCGCCG
ACGCAGCGGTCGCTTCCTGCTCCACAGTCGGCACAGCAAACCGTCTTCTCCGCGGCAACGATGACTCCGCAGATG
ACTAGTTCCTTGCAGTCGCAAGTGGCTCCTCCTGGTCAAAGCCTCAACGACCTCAGCAATGCCAGAATGCAACAG
CAATACGCGGTACAGATGCAGCAGATGCAGCCTGTTGTGTCGGGATATGGCGGCATGCAGCCTCAATCCATAATA
GGTTTCCCCACGGGCCAGCCCATGATGCAGCAGCCCATGATGACAGGAATGTCGGGTGCCAGTCCCTTTGCCGAT
CCCGTTCGTCAAAGCCAGTTCTCACCTGTTCAGGCACAGCCAACAGGCTTCCAACAGTCTCAGTTCCCCCAAGCA
ATGGCCATGCCTTCATATGGGATGCAACATAGTCAGGCCACCGGAGCCATCAATAACTTCCTACCTCCAGCGCTA
GAGCCACAACGAACTGGGGCTCCTCCACTCATTCCGCAGCCACTGCTGCCGCAAAGGACGGGGCCACCGCCACCA
GTACGGTTTGGCATGCCGGCCGAGGCCAAGAAACTGGCGTCGCAGCAAACTGGGCGAAGGGCAAACTTGGCTCAA
GCTACCCCAGATAATCCATTCGGGTTTTGA
Gene >OphauG2|289
ATGGTGTTTCTGGGCGTGTATAAGGCTCTTTACCCCTGGACCGAAAGCGACGATGGCATGCTTCCCATGGAACAA
GGCGACCTCCTATGCATCGTGGGCATGAATGAAGGCAGCGACTGGTGGAGAGCGAAGAAGAAGGCAGTGGCCGAT
GAGGACGATGAGCCCGAGGGCTTCGTACCGAGCAACTATATCGAACCGGTAAGAAGTTGCCGCCTTAGGCGAAGA
TGTCTAGCATCTTGATCATGGCCCGTGTAGCTACTATACTAACGCATTTTGGTTTCTTGGGATGCAATAGGCCCC
CGTACTGGGACACGCTCATACTATCTACGAGTACACGCGCCAGACAGATGAAGAGCTATCTTTTTCGGAAGACGT
TGTGCTGCAAATTTTTGACACGTCGGACCCCGATTGGATTCTCGCCGGTCTCGATGGAGACTTTGGCTTCGTGCC
ATCGAACTACATTGAGATGCAGGCAATAGTCACAGACGAAGTCACCCCCCCACCATCCCCCGACGCTCCACCAAT
TTTGCCTGCAAGACCACAATCAGTCATTACTGAAGCGGAACGGGAGCGGAAGCCGGAAGCGGAGCCGGAACAACA
AAAAGAGGTTAGGTCTCCAAAATCAGGGTCAAGAGGCCCGGCCGGTGCCCTGGCTGGTGTTTTGCAAAGCCGCCA
AAATTCCGTGCAAACTTTGCGGCAACCTCATCACGAGCGTTCAGTATCAGCACGAGATGACGATTACGAGAATGA
TAACGGGTCCCTGTCTTCACCAGCGCTGCCGGATCGTCCACAACCTAGCGTTGACAATGGCTCAAACAGTCGTGA
AGCCAGACCTTGTAACCAGCCCAACAGCCATAACCCTCAACCTGGCGAGGAACCATTGAGAACACCAGGGGGGTT
TCACATGTACAATATCAGCGAGATGGTGTCAGTGATGGGCAAGAGGAAAAAGATGCCGACGACTCTGGGCATCAA
TCTCAAAACAGGCACCATACTCATTGCCCCCGAACACGCTCAAGACGACCCCCCGCAGGAGTGGACAAGCGATAA
GATGAGACACTATTCTCGTGAAGGCAAGCACGTGTTTCTTGAACTTGTCCGTCCTAGCAAGAGTATCGACTTTCA
TGCCGGGGCTAGAGATACTGCTGAAGAGATAATGGGGGCCCTGAGCGACCTTGCTGGTGTCCTCCGGGCTGAGGG
CCTACGAGAGGCTATATTATCAGTCGATAGCGTCCGCAAAGGTCAAGTCCTGTACGACTTTATGGCACAGGGTGA
CGACGAAGTGACAGTAGCAGCTGGAGACCAAGTTTTGGTGTTGGATAATTCCAAGAGCGACGAGTGGTGGCAGGT
CAGGCGTGTCAAGAACGGCAGACAGGGAGTTGTTCCCAGCAGCTACATAGAGTTGACGAAAACATCATCACCAAC
ACCCACGCCTGGGGTTAGCCAGTCGACCATAAATTCGGCCAGATCTACGGTTGAGCAGAATCGGCTCGAAGAGAT
ACGGCTTACCAAGGCGGCCATCAAGGCAAATAGAGAGCCACAGCAGCAGCAGGTAGGGCCGGGAATGCCTCTCCC
TGAAAGAAGTAGCAGTCTCACGGCCAAGGAACGTGGTAATAATTCGAGTCAGCAGAGGAGCCGGCGCGGAAGCAG
TCGAAGCGACTCCAGATCCAAAGCTAGTACGTTGTTTCCACTTGTTTTGGTTTTACTGCTGTCAACAGAAGTTGC
CTGCTGCGCTCGGATTCAAGGTTCTCAGAGTGCTGACATCACCTGGGAAGAACCGGATTCGGCCAAGGTGAGGGC
ATGGACAGATCGCTCAGGAGCCTTCAGCGTCGATGCGCAGTTTCTTGGTCTTCGGGACGGCAAGATTCACTTGCA
TAAGCTCAATGGTGTGAAGATTGCCGTTCCCATTGCCAAGATGTCACAGGCCGATCTTGAGTACGTGGAGCAGAC
TACGGGCATGTCGCTCGACGACGACAAGCCCCTGGCTGATGTAAAGCGAGCCAAGTCGACGACAAAGTCGGCTAA
GGTTGGTGCAACAGTGGGAAGAAGTGATAAGGTAGAACCAGAGTACGACTGGTTTCAGTTTTTTCTCAGCTGTGA
CGTGGCAGTTGGCCTGTGTGAGCGCTATGCTCAGGCCTTTACCCGAGACTCGATGGACGAGAGTGTACTCCCAGA
CGTCAATGTCTCGGTCCTACGAACCTTAGGTCTCCGCGAGGGTGACATTCTCAAGGTGATGCGCCATCTCGACGC
CAAGTTCAACCGTGACCGAAGCAGCACCGCCAGGGCTGAAGATGACAATGCTGCCGGTGGTCTCTTCTCTGGACC
CGGCGGCGCCCTACGCAACAACACGCGCAAGGGCCGTCCGGCGCCTACTGTGCAAACAAATGATGTTGTCGATGC
TGCTGCTCTTTCGGCCTCGAGCGTCGCCAAGAATGGATCCATGGAACTGGCGGTGAGTCCAGTCAAGGCTTCGGC
CGGTGGATTTGATGATGATGCGTGGGAAGTCAAAACGCCGCAATCTAGTAGTAGCGAGAGCAAACGCCAGCAAAA
TCAGCCTGTATATTCCGGGGCCCTCAAGCCTCAAGCTTCGACCATGGTTGCTGAAACACCTCTCATCGGCTCCAT
GAAGGATCTTTCACTCCTAACGCAGCCGCTGCAACCCACCAAGGTTGAGGCGCAGCCAACAGCCGTGAGCCTTGG
CTCAAGTCAAGGCCCTGTCGAGCAAGGACAGCAGCCGTTGCAGCAGCTCGCTGGGGCCAGTCCGTCCTTCTTTTC
ATCCATGCCTCCGCTGCCAACAACATCTCCCCAGTCCCTCCAACCCCTGGCCCGGAACCGACCCCCCCCTCCTCT
ATCCTCTGGCATGTCACCTGGCTTGGGGTCCCTCCCGCCGCCGCCGCCGACGCAGCGGTCGCTTCCTGCTCCACA
GTCGGCACAGCAAACCGTCTTCTCCGCGGCAACGATGACTCCGCAGATGACTAGTTCCTTGCAGTCGCAAGTGGC
TCCTCCTGGTCAAAGCCTCAACGACCTCAGCAATGCCAGAATGCAACAGCAATACGCGGTACAGATGCAGCAGAT
GCAGCCTGTTGTGTCGGGATATGGCGGCATGCAGCCTCAATCCATAATAGGTTTCCCCACGGGCCAGCCCATGAT
GCAGCAGCCCATGATGACAGGAATGTCGGGTGCCAGTCCCTTTGCCGATCCCGTTCGTCAAAGCCAGTTCTCACC
TGTTCAGGCACAGCCAACAGGCTTCCAACAGTCTCAGTTCCCCCAAGCAATGGCCATGCCTTCATATGGGATGCA
ACATAGTCAGGCCACCGGAGCCATCAATAACTTCCTACCTCCAGCGCTAGAGCCACAACGAACTGGGGCTCCTCC
ACTCATTCCGCAGCCACTGCTGCCGCAAAGGACGGGGCCACCGCCACCAGTACGGTTTGGCATGCCGGCCGAGGC
CAAGAAACTGGCGTCGCAGCAAACTGGGCGAAGGGCAAACTTGGCTCAAGCTAGTGAGTACTTTTTCCTATTGCT
TTTTGATCTCAGACCCTCGCGTCTCTTCAAAACGTCAAGTACCGTTTCTAGGCTAATCTCTCTTATCTCTTACAG
CCCCAGATAATCCATTCGGGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail