Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2871
Gene name
LocationContig_210:20770..21895
Strand-
Gene length (bp)1125
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 2.3E-26 149 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SIE0|ALKB2_ARATH DNA oxidative demethylase ALKBH2 OS=Arabidopsis thaliana GN=ALKBH2 PE=2 SV=2 25 292 2.0E-23
sp|Q5XIC8|ALKB3_RAT Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Rattus norvegicus GN=Alkbh3 PE=2 SV=1 145 289 2.0E-21
sp|Q96Q83|ALKB3_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Homo sapiens GN=ALKBH3 PE=1 SV=1 145 289 3.0E-21
sp|Q32L00|ALKB3_BOVIN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Bos taurus GN=ALKBH3 PE=2 SV=1 145 289 8.0E-21
sp|Q6NS38|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 OS=Homo sapiens GN=ALKBH2 PE=1 SV=1 156 293 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SIE0|ALKB2_ARATH DNA oxidative demethylase ALKBH2 OS=Arabidopsis thaliana GN=ALKBH2 PE=2 SV=2 25 292 2.0E-23
sp|Q5XIC8|ALKB3_RAT Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Rattus norvegicus GN=Alkbh3 PE=2 SV=1 145 289 2.0E-21
sp|Q96Q83|ALKB3_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Homo sapiens GN=ALKBH3 PE=1 SV=1 145 289 3.0E-21
sp|Q32L00|ALKB3_BOVIN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Bos taurus GN=ALKBH3 PE=2 SV=1 145 289 8.0E-21
sp|Q6NS38|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 OS=Homo sapiens GN=ALKBH2 PE=1 SV=1 156 293 6.0E-20
sp|Q8K1E6|ALKB3_MOUSE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Mus musculus GN=Alkbh3 PE=1 SV=1 145 289 6.0E-20
sp|Q58DM4|ALKB2_BOVIN DNA oxidative demethylase ALKBH2 OS=Bos taurus GN=ALKBH2 PE=2 SV=1 156 292 6.0E-19
sp|Q6P6J4|ALKB2_MOUSE DNA oxidative demethylase ALKBH2 OS=Mus musculus GN=Alkbh2 PE=1 SV=1 125 292 1.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2871
MSQKRTIDCFFTSAPKRPRVKLHQDENTEPTQASHHVSYPFSILNLPSCLNKDMASLPARPAKAINDQPDLDLLH
FEPYIPGHMTRSLFEFLRAELPFYRVEYDINRRGIQTHIRTPRWTTVFGLDETSYFDQDGSVIDKETAIGAVDKC
YARYPPRPIPQCLDSLRTSTEAATGCSFNFCLVNYYASGADSISFHSDDERFLGKDPAIASFSLGARRDFLLKHK
PPPAGSNTSLASDATAKAKPLKLALASGDMIVMRGKTQSNWLHSIPKRGGKNEQDGGRINITFRRALIKEGTENY
YNYNVGTGPVYRWDNVSRQMTVWKP*
Coding >OphauG2|2871
ATGTCCCAGAAACGCACCATTGACTGCTTCTTTACCTCGGCTCCCAAACGTCCGAGGGTGAAGCTGCATCAAGAC
GAAAACACTGAGCCTACGCAGGCATCGCACCATGTTAGCTATCCATTTTCGATACTTAATTTGCCATCTTGTCTC
AACAAAGATATGGCTTCTCTGCCCGCACGTCCCGCAAAGGCCATCAATGACCAGCCCGACCTCGACTTGCTCCAT
TTTGAGCCCTATATCCCTGGTCATATGACTCGTTCCTTATTTGAGTTCTTGCGAGCCGAATTGCCCTTTTACCGA
GTCGAGTACGACATCAACCGTCGAGGTATTCAGACACATATACGTACTCCAAGATGGACCACCGTCTTTGGGCTG
GACGAGACGTCTTACTTTGATCAAGATGGCTCCGTCATTGACAAGGAGACAGCCATTGGGGCGGTTGACAAGTGT
TATGCCCGATATCCTCCGCGGCCCATTCCCCAGTGTCTCGACAGCCTCCGCACTTCCACAGAGGCTGCAACGGGC
TGCAGCTTCAACTTTTGTCTCGTCAACTACTATGCTTCGGGCGCAGACAGTATTTCTTTCCACAGTGATGATGAG
AGATTCCTAGGCAAGGATCCCGCCATTGCCTCCTTCTCCTTGGGTGCACGCCGAGACTTTCTACTCAAGCACAAG
CCTCCCCCGGCAGGCAGCAACACCTCTCTGGCATCAGATGCCACAGCCAAGGCCAAGCCACTCAAGCTTGCGCTG
GCAAGTGGCGACATGATAGTCATGAGGGGCAAGACGCAGTCCAACTGGCTCCACTCCATTCCCAAACGTGGCGGC
AAGAATGAACAAGACGGTGGTCGAATCAACATAACATTTCGGAGGGCCTTGATCAAGGAAGGGACAGAGAACTAT
TACAATTATAACGTGGGCACTGGCCCAGTGTACCGCTGGGACAATGTAAGTCGCCAGATGACGGTATGGAAGCCA
TGA
Transcript >OphauG2|2871
ATGTCCCAGAAACGCACCATTGACTGCTTCTTTACCTCGGCTCCCAAACGTCCGAGGGTGAAGCTGCATCAAGAC
GAAAACACTGAGCCTACGCAGGCATCGCACCATGTTAGCTATCCATTTTCGATACTTAATTTGCCATCTTGTCTC
AACAAAGATATGGCTTCTCTGCCCGCACGTCCCGCAAAGGCCATCAATGACCAGCCCGACCTCGACTTGCTCCAT
TTTGAGCCCTATATCCCTGGTCATATGACTCGTTCCTTATTTGAGTTCTTGCGAGCCGAATTGCCCTTTTACCGA
GTCGAGTACGACATCAACCGTCGAGGTATTCAGACACATATACGTACTCCAAGATGGACCACCGTCTTTGGGCTG
GACGAGACGTCTTACTTTGATCAAGATGGCTCCGTCATTGACAAGGAGACAGCCATTGGGGCGGTTGACAAGTGT
TATGCCCGATATCCTCCGCGGCCCATTCCCCAGTGTCTCGACAGCCTCCGCACTTCCACAGAGGCTGCAACGGGC
TGCAGCTTCAACTTTTGTCTCGTCAACTACTATGCTTCGGGCGCAGACAGTATTTCTTTCCACAGTGATGATGAG
AGATTCCTAGGCAAGGATCCCGCCATTGCCTCCTTCTCCTTGGGTGCACGCCGAGACTTTCTACTCAAGCACAAG
CCTCCCCCGGCAGGCAGCAACACCTCTCTGGCATCAGATGCCACAGCCAAGGCCAAGCCACTCAAGCTTGCGCTG
GCAAGTGGCGACATGATAGTCATGAGGGGCAAGACGCAGTCCAACTGGCTCCACTCCATTCCCAAACGTGGCGGC
AAGAATGAACAAGACGGTGGTCGAATCAACATAACATTTCGGAGGGCCTTGATCAAGGAAGGGACAGAGAACTAT
TACAATTATAACGTGGGCACTGGCCCAGTGTACCGCTGGGACAATGTAAGTCGCCAGATGACGGTATGGAAGCCA
TGA
Gene >OphauG2|2871
ATGTCCCAGAAACGCACCATTGACTGCTTCTTTACCTCGGCTCCCAAACGTCCGAGGGTGAAGCTGCATCAAGAC
GAAAACACTGAGCCTGTCAGACTCATGAGTACCGTCCACACATGTTTCTCTCACATCAACAAGCTTTCGCTTTGC
TAACACTTGGCACAGACGCAGGCATCGCACCATGTTAGCTATCCATTTTCGATACTTAATTTGCCATCTTGTCTC
AACAAAGATATGGCTTCTCTGCCCGCACGTCCCGCAAAGGCCATCAATGACCAGCCCGACCTCGACTTGCTCCAT
TTTGAGCCCTATATCCCTGGTCATATGACTCGTTCCTTATTTGAGTTCTTGCGAGCCGAATTGCCCTTTTACCGA
GTCGAGTACGACATCAACCGTCGAGGTATTCAGACACATATACGTACTCCAAGGCTCGTTTCTCGTCCTCGACTT
GACCGTTGAAAGACATGCAACTAACGCTGTTCGCATAAAAACAACAACAGATGGACCACCGTCTTTGGGCTGGAC
GAGACGTCTTACTTTGATCAAGATGGCTCCGTCATTGACAAGGAGACAGCCATTGGGGCGGTTGACAAGTGTTAT
GCCCGATATCCTCCGCGGCCCATTCCCCAGTGTCTCGACAGCCTCCGCACTTCCACAGAGGCTGCAACGGGCTGC
AGCTTCAACTTTTGTCTCGTCAACTACTATGCTTCGGGCGCAGACAGTATTTCTTTCCACAGTGATGATGAGAGA
TTCCTAGGCAAGGATCCCGCCATTGCCTCCTTCTCCTTGGGTGCACGCCGAGACTTTCTACTCAAGCACAAGCCT
CCCCCGGCAGGCAGCAACACCTCTCTGGCATCAGATGCCACAGCCAAGGCCAAGCCACTCAAGCTTGCGCTGGCA
AGTGGCGACATGATAGTCATGAGGGGCAAGACGCAGTCCAACTGGCTCCACTCCATTCCCAAACGTGGCGGCAAG
AATGAACAAGACGGTGGTCGAATCAACATAACATTTCGGAGGGCCTTGATCAAGGAAGGGACAGAGAACTATTAC
AATTATAACGTGGGCACTGGCCCAGTGTACCGCTGGGACAATGTAAGTCGCCAGATGACGGTATGGAAGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail