Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2868
Gene name
LocationContig_210:14986..16389
Strand+
Gene length (bp)1403
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01207 Dus Dihydrouridine synthase (Dus) 1.1E-32 40 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O95620|DUS4L_HUMAN tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS4L PE=2 SV=2 23 339 1.0E-53
sp|O74553|DUS4_SCHPO tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus4 PE=3 SV=1 23 375 1.0E-51
sp|Q32M08|DUS4L_MOUSE tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus4l PE=2 SV=1 23 339 2.0E-51
sp|Q06063|DUS4_YEAST tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS4 PE=1 SV=1 23 375 4.0E-51
sp|Q09504|YQI2_CAEEL Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 OS=Caenorhabditis elegans GN=C45G9.2 PE=3 SV=2 43 369 2.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O95620|DUS4L_HUMAN tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS4L PE=2 SV=2 23 339 1.0E-53
sp|O74553|DUS4_SCHPO tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus4 PE=3 SV=1 23 375 1.0E-51
sp|Q32M08|DUS4L_MOUSE tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus4l PE=2 SV=1 23 339 2.0E-51
sp|Q06063|DUS4_YEAST tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS4 PE=1 SV=1 23 375 4.0E-51
sp|Q09504|YQI2_CAEEL Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 OS=Caenorhabditis elegans GN=C45G9.2 PE=3 SV=2 43 369 2.0E-45
sp|Q6P1R4|DUS1L_HUMAN tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS1L PE=1 SV=1 41 388 2.0E-28
sp|Q8C2P3|DUS1L_MOUSE tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus1l PE=2 SV=1 41 339 1.0E-27
sp|Q8K582|DUS1L_RAT tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus1l PE=2 SV=1 41 339 3.0E-27
sp|Q9HGN6|DUS1_SCHPO tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus1 PE=3 SV=1 38 309 9.0E-23
sp|P53759|DUS1_YEAST tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS1 PE=1 SV=1 6 304 4.0E-16
sp|O74731|DUS2_SCHPO tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus2 PE=3 SV=1 41 260 2.0E-13
sp|P53720|DUS2_YEAST tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMM1 PE=1 SV=1 41 307 7.0E-11
sp|O67533|DUS_AQUAE Probable tRNA-dihydrouridine synthase OS=Aquifex aeolicus (strain VF5) GN=dus PE=3 SV=1 41 304 3.0E-10
sp|Q8Z5B2|DUSC_SALTI tRNA-dihydrouridine(16) synthase OS=Salmonella typhi GN=dusC PE=3 SV=1 84 339 9.0E-08
sp|Q9CJW1|DUSC_PASMU tRNA-dihydrouridine(16) synthase OS=Pasteurella multocida (strain Pm70) GN=dusC PE=3 SV=1 94 339 1.0E-07
sp|Q7VKU5|DUSC_HAEDU tRNA-dihydrouridine(16) synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dusC PE=3 SV=1 94 303 2.0E-07
sp|Q8ZNM4|DUSC_SALTY tRNA-dihydrouridine(16) synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusC PE=3 SV=1 87 339 3.0E-07
sp|O68273|DUSC_CUPNH tRNA-dihydrouridine(16) synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dusC PE=3 SV=2 65 270 4.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1452
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2868 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2255
Ophiocordyceps camponoti-floridani Ophcf2|05114
Ophiocordyceps camponoti-rufipedis Ophun1|7510
Ophiocordyceps kimflemingae Ophio5|4373
Ophiocordyceps subramaniannii Hirsu2|11

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2868
MALHGEPSSESHQALVASCQGHPLKIFDAARSRDRFVRACAPMVRYSKLAFRQTVHQFGVDLCWTPMILAKEFNR
NSFARDSDLTVSTLPHQPPTIIQFGANCPTELSRAASLAASCVSGIDLNCGCPQSWACASSLGAALMSRRELVRD
MVMETRAALVRDGWLVGFDDTQVASPLGRSVSVKIRLHSDLRRTIDFMDTLLGLGGSQGQRLVDWITIHPRTRNT
PSSVPIDTQALQLLTSRYAATLPILLSGDVFDLADLPMASTHTSCPAPDAAVIDAPKPSNTGLAGFMSARGLLAN
PALFAGHSSCPWLALETFMCNAARSPLPFKLLLHHVAQMCAPGMGADKTALLPKRDRASLVKIDNMLDLVDFLDQ
KCGELTGRQGGLRRDL*
Coding >OphauG2|2868
ATGGCACTACACGGGGAGCCCTCGTCCGAGAGCCACCAAGCCCTCGTGGCTTCTTGCCAGGGCCACCCGCTCAAG
ATCTTTGACGCGGCGCGCTCTCGAGATCGCTTTGTGCGCGCCTGTGCTCCCATGGTGCGGTATAGCAAGCTCGCC
TTTCGCCAGACAGTGCATCAGTTTGGCGTCGACTTGTGCTGGACGCCCATGATTCTGGCAAAGGAATTCAATCGC
AACAGCTTCGCCCGAGATAGCGACTTGACCGTCTCAACGCTCCCCCACCAGCCTCCCACCATTATCCAGTTTGGC
GCAAATTGCCCCACCGAGCTCTCGCGTGCTGCCTCCCTCGCGGCTTCTTGTGTCTCGGGCATCGACCTCAACTGT
GGCTGTCCCCAGTCCTGGGCCTGCGCTTCTTCTCTGGGCGCCGCACTCATGTCTCGCCGTGAGCTTGTGCGCGAC
ATGGTGATGGAGACACGTGCTGCCCTCGTCCGTGATGGCTGGCTTGTGGGCTTTGACGACACCCAAGTAGCCAGT
CCGCTTGGGAGGAGTGTCAGCGTCAAGATTCGACTCCATTCTGACCTGCGCCGCACCATTGACTTCATGGACACC
CTGCTGGGCTTGGGGGGAAGCCAAGGACAGCGTCTGGTGGATTGGATCACTATTCACCCGCGCACCAGAAACACG
CCGTCGTCTGTACCCATAGACACACAGGCGTTGCAGCTATTGACGTCGCGATATGCAGCCACCCTACCCATCCTT
CTCTCTGGCGACGTCTTTGATCTCGCCGACCTGCCCATGGCCTCGACTCACACCTCGTGTCCCGCCCCAGATGCT
GCTGTTATAGACGCCCCAAAACCTAGCAACACTGGCCTTGCTGGCTTCATGTCGGCACGCGGCCTCCTCGCCAAC
CCGGCCCTCTTCGCAGGCCACTCGTCATGCCCCTGGCTTGCCCTCGAGACCTTTATGTGCAACGCCGCACGCTCC
CCTCTGCCCTTCAAGCTCCTCCTTCATCACGTGGCCCAGATGTGCGCCCCAGGCATGGGGGCCGACAAGACAGCA
CTTCTGCCCAAGCGCGACCGTGCCAGCCTCGTCAAAATCGACAATATGCTTGATCTGGTTGACTTTCTGGACCAA
AAATGCGGCGAGCTCACAGGGCGACAGGGCGGGCTGCGACGCGACCTGTAA
Transcript >OphauG2|2868
ATGGCACTACACGGGGAGCCCTCGTCCGAGAGCCACCAAGCCCTCGTGGCTTCTTGCCAGGGCCACCCGCTCAAG
ATCTTTGACGCGGCGCGCTCTCGAGATCGCTTTGTGCGCGCCTGTGCTCCCATGGTGCGGTATAGCAAGCTCGCC
TTTCGCCAGACAGTGCATCAGTTTGGCGTCGACTTGTGCTGGACGCCCATGATTCTGGCAAAGGAATTCAATCGC
AACAGCTTCGCCCGAGATAGCGACTTGACCGTCTCAACGCTCCCCCACCAGCCTCCCACCATTATCCAGTTTGGC
GCAAATTGCCCCACCGAGCTCTCGCGTGCTGCCTCCCTCGCGGCTTCTTGTGTCTCGGGCATCGACCTCAACTGT
GGCTGTCCCCAGTCCTGGGCCTGCGCTTCTTCTCTGGGCGCCGCACTCATGTCTCGCCGTGAGCTTGTGCGCGAC
ATGGTGATGGAGACACGTGCTGCCCTCGTCCGTGATGGCTGGCTTGTGGGCTTTGACGACACCCAAGTAGCCAGT
CCGCTTGGGAGGAGTGTCAGCGTCAAGATTCGACTCCATTCTGACCTGCGCCGCACCATTGACTTCATGGACACC
CTGCTGGGCTTGGGGGGAAGCCAAGGACAGCGTCTGGTGGATTGGATCACTATTCACCCGCGCACCAGAAACACG
CCGTCGTCTGTACCCATAGACACACAGGCGTTGCAGCTATTGACGTCGCGATATGCAGCCACCCTACCCATCCTT
CTCTCTGGCGACGTCTTTGATCTCGCCGACCTGCCCATGGCCTCGACTCACACCTCGTGTCCCGCCCCAGATGCT
GCTGTTATAGACGCCCCAAAACCTAGCAACACTGGCCTTGCTGGCTTCATGTCGGCACGCGGCCTCCTCGCCAAC
CCGGCCCTCTTCGCAGGCCACTCGTCATGCCCCTGGCTTGCCCTCGAGACCTTTATGTGCAACGCCGCACGCTCC
CCTCTGCCCTTCAAGCTCCTCCTTCATCACGTGGCCCAGATGTGCGCCCCAGGCATGGGGGCCGACAAGACAGCA
CTTCTGCCCAAGCGCGACCGTGCCAGCCTCGTCAAAATCGACAATATGCTTGATCTGGTTGACTTTCTGGACCAA
AAATGCGGCGAGCTCACAGGGCGACAGGGCGGGCTGCGACGCGACCTGTAA
Gene >OphauG2|2868
ATGGCACTACACGGGGAGCCCTCGTCCGAGAGCCACCAAGCCCTCGTGGCTTCTTGCCAGGGCCAGTAAGTGAAG
AGCTCCCCTCGGCAAGCCCAAGGCGCGGGCCATGGAGTCGGGCTAATGCTCGTCTTGCTCAACAGCCCGCTCAAG
ATCTTTGACGCGGCGCGCTCTCGAGATCGCTTTGTGCGCGCCTGTGCTCCCATGGTGCGGTATAGCAAGGCAAGT
GTTTGCTGGCCGCGCTTTTCTTGACATGACTTGTCCACTTGCTTTCTTGGTCTCGTCTGCCAAGACACACTCTTC
TCATTGTTTTGCCAGCTCGCCTTTCGCCAGACAGTGCATCAGTTTGGCGTCGACTTGTGCTGGACGCCCATGATT
CTGGCAAAGGAATTCAATCGCAACAGCTTCGCCCGAGATAGCGGTGCGTCTTGTCCTCTGCCTCCCTCATCGTCA
GCTGACGCCTGCTGGCGCAACAAGACTTGACCGTCTCAACGCTCCCCCACCAGCCTCCCACCATTATCCAGTTTG
GCGCAAATTGCCCCACCGAGCTCTCGCGTGCTGCCTCCCTCGCGGCTTCTTGTGTCTCGGGCATCGACCTCAACT
GTGGCTGTCCCCAGTCCTGGGCCTGCGCTTCTTCTCTGGGCGCCGCACTCATGTCTCGCCGTGAGCTTGTGCGCG
ACATGGTGATGGAGACACGTGCTGCCCTCGTCCGTGATGGCTGGCTTGTGGGCTTTGACGACACCCAAGTAGCCA
GTCCGCTTGGGAGGAGTGTCAGCGTCAAGATTCGACTCCATTCTGACCTGCGCCGCACCATTGACTTCATGGACA
CCCTGCTGGGCTTGGGGGGAAGCCAAGGACAGCGTCTGGTGGATTGGATCACTATTCACCCGCGCACCAGAAACA
CGCCGTCGTCTGTACCCATAGACACACAGGCGTTGCAGCTATTGACGTCGCGATATGCAGCCACCCTACCCATCC
TTCTCTCTGGCGACGTCTTTGATCTCGCCGACCTGCCCATGGCCTCGACTCACACCTCGTGTCCCGCCCCAGATG
CTGCTGTTATAGACGCCCCAAAACCTAGCAACACTGGCCTTGCTGGCTTCATGTCGGCACGCGGCCTCCTCGCCA
ACCCGGCCCTCTTCGCAGGCCACTCGTCATGCCCCTGGCTTGCCCTCGAGACCTTTATGTGCAACGCCGCACGCT
CCCCTCTGCCCTTCAAGCTCCTCCTTCATCACGTGGCCCAGATGTGCGCCCCAGGCATGGGGGCCGACAAGACAG
CACTTCTGCCCAAGCGCGACCGTGCCAGCCTCGTCAAAATCGACAATATGCTTGATCTGGTTGACTTTCTGGACC
AAAAATGCGGCGAGCTCACAGGGCGACAGGGCGGGCTGCGACGCGACCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail