Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2863
Gene name
LocationContig_210:7519..8488
Strand+
Gene length (bp)969
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01674 Lipase_2 Lipase (class 2) 8.9E-07 75 164

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25275|LIP_PSES5 Lipase OS=Pseudomonas sp. (strain KWI-56) GN=lip PE=1 SV=1 76 203 3.0E-08
sp|P22088|LIP_BURCE Lipase OS=Burkholderia cepacia GN=lipA PE=1 SV=2 76 203 6.0E-08
sp|Q05489|LIP_BURGL Lipase OS=Burkholderia glumae GN=lipA PE=1 SV=1 76 201 2.0E-07

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0016042 lipid catabolic process Yes
GO:0003674 molecular_function No
GO:1901575 organic substance catabolic process No
GO:0006629 lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0009056 catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999626

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3279
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2863 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2250
Ophiocordyceps camponoti-floridani Ophcf2|05110
Ophiocordyceps camponoti-rufipedis Ophun1|7507
Ophiocordyceps kimflemingae Ophio5|2037
Ophiocordyceps subramaniannii Hirsu2|6

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2863
MLLSTLLLGLMSLLISLAASSPFYDDMDANRFKQIESTIRAWEKQRKKELKNAGPDEPLFPIRNDWSCKSPRHSN
PIIMLHGLSGTRQLEVNFLELWLRRQGFCTFSFTYGSWSRILPELPFLGGVRAVDDSSNEIATFVQQVIAATNSS
KVDIVGHSEGAFLAIYIPRFWPLVGNAAQNIIAIGPPTRGTTLRKFFASTLVFGARSRRAWRKVLGKMGCPACDE
LLPDGAPIMRLRAATPVRLPHTTLTIIATRHDRTITPPETAFLYEPGVRNMYIQDDCPADPVEHIGLAVDFNVWN
VVRNTLDKQFDRKYQCVAGLRI*
Coding >OphauG2|2863
ATGCTCCTCTCGACTCTGTTGCTGGGACTCATGTCCCTGTTGATCAGCCTCGCCGCCAGCTCGCCCTTCTACGAC
GACATGGACGCCAACCGCTTCAAGCAAATCGAATCCACCATCAGGGCGTGGGAGAAGCAGCGCAAAAAGGAACTC
AAAAACGCCGGCCCCGACGAGCCCCTATTCCCCATCCGCAACGACTGGAGCTGCAAGAGCCCGCGCCACAGCAAC
CCCATCATCATGCTCCACGGTCTGTCGGGCACGCGCCAGCTCGAGGTCAACTTTCTCGAGCTGTGGCTTCGCCGC
CAGGGCTTCTGCACCTTTTCCTTCACCTATGGCAGCTGGTCCCGCATCCTACCCGAGCTCCCCTTTCTCGGCGGT
GTCCGCGCCGTCGACGACTCGAGCAACGAGATTGCAACCTTTGTCCAGCAGGTCATTGCCGCCACCAACTCGTCC
AAGGTTGATATTGTCGGCCACTCCGAGGGCGCCTTTCTCGCCATCTATATCCCTCGCTTCTGGCCTCTGGTGGGC
AACGCCGCCCAAAACATCATTGCCATTGGGCCCCCGACTCGCGGCACCACCCTGCGCAAGTTCTTTGCCTCGACT
CTCGTCTTTGGTGCTCGGAGCCGTCGCGCCTGGCGCAAGGTGCTGGGCAAGATGGGCTGTCCTGCTTGTGACGAA
CTGCTGCCCGATGGCGCGCCCATCATGCGTCTCAGAGCCGCCACGCCCGTCCGTCTGCCTCACACCACCCTCACA
ATCATTGCCACTCGCCATGACAGGACCATTACACCACCTGAAACCGCCTTTTTGTACGAGCCCGGCGTCCGCAAC
ATGTACATCCAGGATGACTGCCCAGCCGACCCTGTCGAGCACATTGGCCTTGCCGTCGACTTCAATGTGTGGAAT
GTTGTCCGCAATACACTCGATAAGCAGTTTGATCGCAAGTACCAGTGCGTCGCCGGCCTTCGCATATAG
Transcript >OphauG2|2863
ATGCTCCTCTCGACTCTGTTGCTGGGACTCATGTCCCTGTTGATCAGCCTCGCCGCCAGCTCGCCCTTCTACGAC
GACATGGACGCCAACCGCTTCAAGCAAATCGAATCCACCATCAGGGCGTGGGAGAAGCAGCGCAAAAAGGAACTC
AAAAACGCCGGCCCCGACGAGCCCCTATTCCCCATCCGCAACGACTGGAGCTGCAAGAGCCCGCGCCACAGCAAC
CCCATCATCATGCTCCACGGTCTGTCGGGCACGCGCCAGCTCGAGGTCAACTTTCTCGAGCTGTGGCTTCGCCGC
CAGGGCTTCTGCACCTTTTCCTTCACCTATGGCAGCTGGTCCCGCATCCTACCCGAGCTCCCCTTTCTCGGCGGT
GTCCGCGCCGTCGACGACTCGAGCAACGAGATTGCAACCTTTGTCCAGCAGGTCATTGCCGCCACCAACTCGTCC
AAGGTTGATATTGTCGGCCACTCCGAGGGCGCCTTTCTCGCCATCTATATCCCTCGCTTCTGGCCTCTGGTGGGC
AACGCCGCCCAAAACATCATTGCCATTGGGCCCCCGACTCGCGGCACCACCCTGCGCAAGTTCTTTGCCTCGACT
CTCGTCTTTGGTGCTCGGAGCCGTCGCGCCTGGCGCAAGGTGCTGGGCAAGATGGGCTGTCCTGCTTGTGACGAA
CTGCTGCCCGATGGCGCGCCCATCATGCGTCTCAGAGCCGCCACGCCCGTCCGTCTGCCTCACACCACCCTCACA
ATCATTGCCACTCGCCATGACAGGACCATTACACCACCTGAAACCGCCTTTTTGTACGAGCCCGGCGTCCGCAAC
ATGTACATCCAGGATGACTGCCCAGCCGACCCTGTCGAGCACATTGGCCTTGCCGTCGACTTCAATGTGTGGAAT
GTTGTCCGCAATACACTCGATAAGCAGTTTGATCGCAAGTACCAGTGCGTCGCCGGCCTTCGCATATAG
Gene >OphauG2|2863
ATGCTCCTCTCGACTCTGTTGCTGGGACTCATGTCCCTGTTGATCAGCCTCGCCGCCAGCTCGCCCTTCTACGAC
GACATGGACGCCAACCGCTTCAAGCAAATCGAATCCACCATCAGGGCGTGGGAGAAGCAGCGCAAAAAGGAACTC
AAAAACGCCGGCCCCGACGAGCCCCTATTCCCCATCCGCAACGACTGGAGCTGCAAGAGCCCGCGCCACAGCAAC
CCCATCATCATGCTCCACGGTCTGTCGGGCACGCGCCAGCTCGAGGTCAACTTTCTCGAGCTGTGGCTTCGCCGC
CAGGGCTTCTGCACCTTTTCCTTCACCTATGGCAGCTGGTCCCGCATCCTACCCGAGCTCCCCTTTCTCGGCGGT
GTCCGCGCCGTCGACGACTCGAGCAACGAGATTGCAACCTTTGTCCAGCAGGTCATTGCCGCCACCAACTCGTCC
AAGGTTGATATTGTCGGCCACTCCGAGGGCGCCTTTCTCGCCATCTATATCCCTCGCTTCTGGCCTCTGGTGGGC
AACGCCGCCCAAAACATCATTGCCATTGGGCCCCCGACTCGCGGCACCACCCTGCGCAAGTTCTTTGCCTCGACT
CTCGTCTTTGGTGCTCGGAGCCGTCGCGCCTGGCGCAAGGTGCTGGGCAAGATGGGCTGTCCTGCTTGTGACGAA
CTGCTGCCCGATGGCGCGCCCATCATGCGTCTCAGAGCCGCCACGCCCGTCCGTCTGCCTCACACCACCCTCACA
ATCATTGCCACTCGCCATGACAGGACCATTACACCACCTGAAACCGCCTTTTTGTACGAGCCCGGCGTCCGCAAC
ATGTACATCCAGGATGACTGCCCAGCCGACCCTGTCGAGCACATTGGCCTTGCCGTCGACTTCAATGTGTGGAAT
GTTGTCCGCAATACACTCGATAAGCAGTTTGATCGCAAGTACCAGTGCGTCGCCGGCCTTCGCATATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail