Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2860
Gene name
LocationContig_210:5351..5642
Strand+
Gene length (bp)291
Transcript length (bp)291
Coding sequence length (bp)291
Protein length (aa) 97

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02597 ThiS ThiS family 2.4E-10 14 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0V5W8|MOC2A_PHANO Molybdopterin synthase sulfur carrier subunit OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=cnxG PE=3 SV=2 9 96 7.0E-30
sp|B2WKU1|MOC2A_PYRTR Molybdopterin synthase sulfur carrier subunit OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cnxG PE=3 SV=1 10 96 1.0E-28
sp|Q9Y8C2|MOC2A_EMENI Molybdopterin synthase sulfur carrier subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnxG PE=1 SV=1 12 96 6.0E-25
sp|A2QYG2|MOC2A_ASPNC Molybdopterin synthase sulfur carrier subunit OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cnxG PE=3 SV=1 12 96 4.0E-17
sp|O96033|MOC2A_HUMAN Molybdopterin synthase sulfur carrier subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1 11 96 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0V5W8|MOC2A_PHANO Molybdopterin synthase sulfur carrier subunit OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=cnxG PE=3 SV=2 9 96 7.0E-30
sp|B2WKU1|MOC2A_PYRTR Molybdopterin synthase sulfur carrier subunit OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cnxG PE=3 SV=1 10 96 1.0E-28
sp|Q9Y8C2|MOC2A_EMENI Molybdopterin synthase sulfur carrier subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnxG PE=1 SV=1 12 96 6.0E-25
sp|A2QYG2|MOC2A_ASPNC Molybdopterin synthase sulfur carrier subunit OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cnxG PE=3 SV=1 12 96 4.0E-17
sp|O96033|MOC2A_HUMAN Molybdopterin synthase sulfur carrier subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1 11 96 5.0E-09
sp|Q9Z224|MOC2A_MOUSE Molybdopterin synthase sulfur carrier subunit OS=Mus musculus GN=Mocs2 PE=1 SV=1 11 96 8.0E-08
sp|Q9S7A3|MOC2A_ARATH Molybdopterin synthase sulfur carrier subunit OS=Arabidopsis thaliana GN=At4g10100 PE=2 SV=1 8 96 2.0E-07
sp|A8JJB2|MOC2A_CHLRE Molybdopterin synthase sulfur carrier subunit OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_109356 PE=3 SV=1 11 96 9.0E-07
sp|Q54NM8|MOC2A_DICDI Molybdopterin synthase sulfur carrier subunit OS=Dictyostelium discoideum GN=mocs2s PE=3 SV=1 10 96 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7248
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2860 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05108

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2860
MTPMPSRSNGHFKILYFAGASSFTGKEGETLPAPLSLNKLFSELEARYPGIKQGVLESCLVTINLEYVDVPGEHV
TDGTVIKEADEVAIIPPVSSG*
Coding >OphauG2|2860
ATGACGCCTATGCCCTCGCGGTCAAACGGCCACTTTAAAATCCTCTACTTTGCCGGTGCTAGTTCCTTTACGGGC
AAGGAAGGCGAGACGCTGCCAGCTCCACTCTCACTGAACAAGCTTTTTTCGGAGCTCGAGGCGAGATACCCAGGC
ATCAAACAAGGGGTGCTTGAGTCTTGCTTGGTGACAATCAACCTCGAGTATGTAGATGTGCCGGGCGAGCATGTC
ACAGACGGCACTGTCATCAAGGAGGCAGACGAGGTGGCAATAATCCCTCCTGTCAGCTCTGGCTGA
Transcript >OphauG2|2860
ATGACGCCTATGCCCTCGCGGTCAAACGGCCACTTTAAAATCCTCTACTTTGCCGGTGCTAGTTCCTTTACGGGC
AAGGAAGGCGAGACGCTGCCAGCTCCACTCTCACTGAACAAGCTTTTTTCGGAGCTCGAGGCGAGATACCCAGGC
ATCAAACAAGGGGTGCTTGAGTCTTGCTTGGTGACAATCAACCTCGAGTATGTAGATGTGCCGGGCGAGCATGTC
ACAGACGGCACTGTCATCAAGGAGGCAGACGAGGTGGCAATAATCCCTCCTGTCAGCTCTGGCTGA
Gene >OphauG2|2860
ATGACGCCTATGCCCTCGCGGTCAAACGGCCACTTTAAAATCCTCTACTTTGCCGGTGCTAGTTCCTTTACGGGC
AAGGAAGGCGAGACGCTGCCAGCTCCACTCTCACTGAACAAGCTTTTTTCGGAGCTCGAGGCGAGATACCCAGGC
ATCAAACAAGGGGTGCTTGAGTCTTGCTTGGTGACAATCAACCTCGAGTATGTAGATGTGCCGGGCGAGCATGTC
ACAGACGGCACTGTCATCAAGGAGGCAGACGAGGTGGCAATAATCCCTCCTGTCAGCTCTGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail