Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2858
Gene name
LocationContig_210:970..2374
Strand-
Gene length (bp)1404
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14474 RTC4 RTC4-like domain 2.5E-30 356 464

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1906
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2858 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2247
Ophiocordyceps camponoti-floridani Ophcf2|05106
Ophiocordyceps camponoti-rufipedis Ophun1|7504
Ophiocordyceps kimflemingae Ophio5|2777
Ophiocordyceps subramaniannii Hirsu2|2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2858
MSGTRLGLSKQQHPPPLLNFVASKSRKIHHERNIDDPPMSSDDEEDGPENGLQSHSSTNSRLASGQGGGTRSSCA
RGDIKSTTFASSCQATGGQRGVRRSSERLGSKTVRDSTPPCQKRQRVDQEKGKISPPSHDRTERPFLPRRPRITR
TYGDNKSKRAGPGLIVPPCIAKSPVKHSSSKSLRVPSALAAKDDASSTEETEGKASGNQKLKSRPAMAPDEPPSP
CRPLFKVPLELSEIERRTDSPNEVENSSDVFHNEVDHDCDESPMVALQQGKPEEAKCPWCGKVVDKGLLDDFFQG
KHMKVQMQMRFCQIHKKHSAVEAWQSRGYPDIDWQTLVGRFAAHRNFLLDIINGENSFFRTIQAHKIATGQARTV
LKEGNLTPGYYGPRGFDMMCDYLGEEYKNELKDRARSDRVIAGRGVAAFVQTVLVAELAVRLIKDDMGVSEEDAR
EILEESKAVGDLVHTEA*
Coding >OphauG2|2858
ATGAGCGGCACCAGGCTGGGTTTGAGCAAACAGCAGCACCCTCCACCACTGTTGAATTTTGTGGCGAGCAAGTCA
CGCAAAATCCACCATGAGAGAAACATAGACGACCCTCCCATGTCGAGCGACGATGAGGAGGACGGTCCGGAAAAT
GGGTTGCAGAGTCACTCGAGCACCAACAGTCGTCTTGCATCAGGCCAGGGTGGAGGGACAAGATCGAGTTGTGCG
CGGGGCGATATCAAATCCACCACTTTTGCTTCATCTTGTCAAGCCACGGGAGGACAGCGAGGTGTCAGGAGGAGC
AGCGAACGGCTTGGATCCAAAACTGTCCGTGATTCAACGCCGCCATGCCAGAAGCGACAGCGAGTCGACCAGGAA
AAAGGCAAGATTTCTCCCCCAAGCCACGACAGGACGGAACGACCTTTTCTGCCCAGACGGCCCAGAATCACGAGA
ACATATGGCGACAATAAGTCTAAACGCGCAGGGCCGGGGCTCATAGTTCCACCTTGTATAGCCAAGAGTCCTGTC
AAGCATTCATCGAGTAAGAGTTTACGTGTTCCCTCGGCCCTTGCTGCCAAAGACGACGCAAGCAGCACAGAAGAG
ACAGAAGGAAAGGCATCTGGTAACCAAAAGTTGAAATCGAGGCCAGCCATGGCCCCAGACGAGCCACCGTCACCA
TGCAGGCCTCTATTCAAAGTGCCATTGGAATTGTCAGAAATTGAGCGCCGAACAGATAGCCCCAACGAAGTGGAA
AACTCATCAGATGTATTCCACAACGAGGTAGACCATGATTGTGACGAATCCCCCATGGTAGCTTTGCAACAAGGC
AAGCCAGAAGAAGCAAAGTGTCCGTGGTGTGGAAAGGTGGTCGACAAGGGGCTGCTCGACGATTTCTTCCAAGGC
AAACACATGAAGGTGCAGATGCAAATGCGCTTCTGCCAAATTCACAAGAAACACTCGGCGGTAGAAGCGTGGCAG
AGTAGAGGCTATCCCGATATAGACTGGCAGACGCTTGTGGGTCGCTTTGCTGCGCACCGCAACTTTTTACTCGAT
ATCATCAACGGCGAAAATTCCTTCTTTCGTACCATTCAGGCACACAAAATTGCCACTGGTCAAGCGAGGACAGTT
CTCAAGGAAGGGAATCTGACTCCGGGATACTACGGGCCCCGTGGCTTCGACATGATGTGTGACTACCTTGGCGAA
GAGTACAAGAACGAGCTCAAGGATAGAGCCAGGAGTGACCGGGTTATTGCTGGGCGAGGAGTGGCGGCCTTTGTG
CAGACGGTTCTGGTGGCCGAGTTGGCAGTCCGACTCATCAAGGACGACATGGGAGTGTCTGAAGAGGATGCGAGG
GAGATTTTGGAAGAGAGTAAGGCGGTCGGCGACTTGGTGCACACGGAAGCATGA
Transcript >OphauG2|2858
ATGAGCGGCACCAGGCTGGGTTTGAGCAAACAGCAGCACCCTCCACCACTGTTGAATTTTGTGGCGAGCAAGTCA
CGCAAAATCCACCATGAGAGAAACATAGACGACCCTCCCATGTCGAGCGACGATGAGGAGGACGGTCCGGAAAAT
GGGTTGCAGAGTCACTCGAGCACCAACAGTCGTCTTGCATCAGGCCAGGGTGGAGGGACAAGATCGAGTTGTGCG
CGGGGCGATATCAAATCCACCACTTTTGCTTCATCTTGTCAAGCCACGGGAGGACAGCGAGGTGTCAGGAGGAGC
AGCGAACGGCTTGGATCCAAAACTGTCCGTGATTCAACGCCGCCATGCCAGAAGCGACAGCGAGTCGACCAGGAA
AAAGGCAAGATTTCTCCCCCAAGCCACGACAGGACGGAACGACCTTTTCTGCCCAGACGGCCCAGAATCACGAGA
ACATATGGCGACAATAAGTCTAAACGCGCAGGGCCGGGGCTCATAGTTCCACCTTGTATAGCCAAGAGTCCTGTC
AAGCATTCATCGAGTAAGAGTTTACGTGTTCCCTCGGCCCTTGCTGCCAAAGACGACGCAAGCAGCACAGAAGAG
ACAGAAGGAAAGGCATCTGGTAACCAAAAGTTGAAATCGAGGCCAGCCATGGCCCCAGACGAGCCACCGTCACCA
TGCAGGCCTCTATTCAAAGTGCCATTGGAATTGTCAGAAATTGAGCGCCGAACAGATAGCCCCAACGAAGTGGAA
AACTCATCAGATGTATTCCACAACGAGGTAGACCATGATTGTGACGAATCCCCCATGGTAGCTTTGCAACAAGGC
AAGCCAGAAGAAGCAAAGTGTCCGTGGTGTGGAAAGGTGGTCGACAAGGGGCTGCTCGACGATTTCTTCCAAGGC
AAACACATGAAGGTGCAGATGCAAATGCGCTTCTGCCAAATTCACAAGAAACACTCGGCGGTAGAAGCGTGGCAG
AGTAGAGGCTATCCCGATATAGACTGGCAGACGCTTGTGGGTCGCTTTGCTGCGCACCGCAACTTTTTACTCGAT
ATCATCAACGGCGAAAATTCCTTCTTTCGTACCATTCAGGCACACAAAATTGCCACTGGTCAAGCGAGGACAGTT
CTCAAGGAAGGGAATCTGACTCCGGGATACTACGGGCCCCGTGGCTTCGACATGATGTGTGACTACCTTGGCGAA
GAGTACAAGAACGAGCTCAAGGATAGAGCCAGGAGTGACCGGGTTATTGCTGGGCGAGGAGTGGCGGCCTTTGTG
CAGACGGTTCTGGTGGCCGAGTTGGCAGTCCGACTCATCAAGGACGACATGGGAGTGTCTGAAGAGGATGCGAGG
GAGATTTTGGAAGAGAGTAAGGCGGTCGGCGACTTGGTGCACACGGAAGCATGA
Gene >OphauG2|2858
ATGAGCGGCACCAGGCTGGGTTTGAGCAAACAGCAGCACCCTCCACCACTGTTGAATTTTGTGGCGAGCAAGTCA
CGCAAAATCCACCATGAGAGAAACATAGACGACCCTCCCATGTCGAGCGACGATGAGGAGGACGGTCCGGAAAAT
GGGTTGCAGAGTCACTCGAGCACCAACAGTCGTCTTGCATCAGGCCAGGGTGGAGGGACAAGATCGAGTTGTGCG
CGGGGCGATATCAAATCCACCACTTTTGCTTCATCTTGTCAAGCCACGGGAGGACAGCGAGGTGTCAGGAGGAGC
AGCGAACGGCTTGGATCCAAAACTGTCCGTGATTCAACGCCGCCATGCCAGAAGCGACAGCGAGTCGACCAGGAA
AAAGGCAAGATTTCTCCCCCAAGCCACGACAGGACGGAACGACCTTTTCTGCCCAGACGGCCCAGAATCACGAGA
ACATATGGCGACAATAAGTCTAAACGCGCAGGGCCGGGGCTCATAGTTCCACCTTGTATAGCCAAGAGTCCTGTC
AAGCATTCATCGAGTAAGAGTTTACGTGTTCCCTCGGCCCTTGCTGCCAAAGACGACGCAAGCAGCACAGAAGAG
ACAGAAGGAAAGGCATCTGGTAACCAAAAGTTGAAATCGAGGCCAGCCATGGCCCCAGACGAGCCACCGTCACCA
TGCAGGCCTCTATTCAAAGTGCCATTGGAATTGTCAGAAATTGAGCGCCGAACAGATAGCCCCAACGAAGTGGAA
AACTCATCAGATGTATTCCACAACGAGGTAGACCATGATTGTGACGAATCCCCCATGGTAGCTTTGCAACAAGGC
AAGCCAGAAGAAGCAAAGTGTCCGTGGTGTGGAAAGGTGGTCGACAAGGGGCTGCTCGACGATTTCTTCCAAGGC
AAACACATGAAGGTGCAGATGCAAATGCGCTTCTGCCAAATTCACAAGAAACACTCGGCGGTAGAAGCGTGGCAG
AGTAGAGGCTATCCCGATATAGACTGGCAGACGCTTGTGGGTCGCTTTGCTGCGCACCGCAACTTTTTACTCGAT
ATCATCAACGGCGAAAATTCCTTCTTTCGTACCATTCAGGCACACAAAATTGCCACTGGTCAAGCGAGGACAGTT
CTCAAGGAAGGGAATCTGACTCCGGGATACTACGGGCCCCGTGGCTTCGACATGATGTGTGACTACCTTGGCGAA
GAGTACAAGAACGAGCTCAAGGATAGAGCCAGGAGTGACCGGGTTATTGCTGGGCGAGGAGTGGCGGCCTTTGTG
CAGACGGTTCTGGTGGCCGAGTTGGCAGTCCGACTCATCAAGGACGACATGGGAGTGTCTGAAGAGGATGCGAGG
GAGATTTTGGAAGAGAGTAAGGCGGTCGGCGACTTGGTGCACACGGAAGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail