Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2856
Gene name
LocationContig_21:50485..51156
Strand-
Gene length (bp)671
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04410 Gar1 Gar1/Naf1 RNA binding region 5.4E-25 29 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06975|GAR1_SCHPO H/ACA ribonucleoprotein complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar1 PE=2 SV=1 20 135 2.0E-52
sp|Q1E6M1|GAR1_COCIM H/ACA ribonucleoprotein complex subunit 1 OS=Coccidioides immitis (strain RS) GN=GAR1 PE=3 SV=1 11 112 3.0E-49
sp|Q6CJ45|GAR1_KLULA H/ACA ribonucleoprotein complex subunit 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAR1 PE=3 SV=1 9 128 5.0E-48
sp|P28007|GAR1_YEAST H/ACA ribonucleoprotein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAR1 PE=1 SV=1 24 145 1.0E-47
sp|A3GHP2|GAR1_PICST H/ACA ribonucleoprotein complex subunit 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=GAR1 PE=3 SV=1 24 122 4.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06975|GAR1_SCHPO H/ACA ribonucleoprotein complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar1 PE=2 SV=1 20 135 2.0E-52
sp|Q1E6M1|GAR1_COCIM H/ACA ribonucleoprotein complex subunit 1 OS=Coccidioides immitis (strain RS) GN=GAR1 PE=3 SV=1 11 112 3.0E-49
sp|Q6CJ45|GAR1_KLULA H/ACA ribonucleoprotein complex subunit 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAR1 PE=3 SV=1 9 128 5.0E-48
sp|P28007|GAR1_YEAST H/ACA ribonucleoprotein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAR1 PE=1 SV=1 24 145 1.0E-47
sp|A3GHP2|GAR1_PICST H/ACA ribonucleoprotein complex subunit 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=GAR1 PE=3 SV=1 24 122 4.0E-47
sp|Q6BVF9|GAR1_DEBHA H/ACA ribonucleoprotein complex subunit 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GAR1 PE=3 SV=1 24 128 6.0E-47
sp|Q2HH48|GAR1_CHAGB H/ACA ribonucleoprotein complex subunit 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GAR1 PE=3 SV=1 24 129 8.0E-47
sp|A6SDR8|GAR1_BOTFB H/ACA ribonucleoprotein complex subunit 1 OS=Botryotinia fuckeliana (strain B05.10) GN=GAR1 PE=3 SV=1 24 115 8.0E-47
sp|A1CVY3|GAR1_NEOFI H/ACA ribonucleoprotein complex subunit 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=gar1 PE=3 SV=1 14 112 4.0E-46
sp|Q6FSB0|GAR1_CANGA H/ACA ribonucleoprotein complex subunit 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GAR1 PE=3 SV=1 24 122 2.0E-45
sp|Q4P5P0|GAR1_USTMA H/ACA ribonucleoprotein complex subunit 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GAR1 PE=3 SV=1 20 128 4.0E-45
sp|P0CN78|GAR1_CRYNJ H/ACA ribonucleoprotein complex subunit 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GAR1 PE=3 SV=1 23 122 5.0E-43
sp|P0CN79|GAR1_CRYNB H/ACA ribonucleoprotein complex subunit 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GAR1 PE=3 SV=1 23 122 5.0E-43
sp|Q757V8|GAR1_ASHGO H/ACA ribonucleoprotein complex subunit 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GAR1 PE=3 SV=1 25 128 2.0E-42
sp|Q9FK53|NLAL2_ARATH H/ACA ribonucleoprotein complex subunit 1-like protein 2 OS=Arabidopsis thaliana GN=At5g18180 PE=2 SV=1 24 119 5.0E-38
sp|Q8VZT0|NLAL1_ARATH Putative H/ACA ribonucleoprotein complex subunit 1-like protein 1 OS=Arabidopsis thaliana GN=At3g03920 PE=2 SV=1 24 119 2.0E-35
sp|Q5RJV1|GAR1_XENTR H/ACA ribonucleoprotein complex subunit 1 OS=Xenopus tropicalis GN=gar1 PE=2 SV=1 24 118 5.0E-28
sp|Q9CY66|GAR1_MOUSE H/ACA ribonucleoprotein complex subunit 1 OS=Mus musculus GN=Gar1 PE=1 SV=1 18 118 1.0E-27
sp|Q9NY12|GAR1_HUMAN H/ACA ribonucleoprotein complex subunit 1 OS=Homo sapiens GN=GAR1 PE=1 SV=1 24 118 1.0E-27
sp|Q7ZVE0|GAR1_DANRE H/ACA ribonucleoprotein complex subunit 1 OS=Danio rerio GN=gar1 PE=2 SV=1 24 118 5.0E-27
sp|Q6AYA1|GAR1_RAT H/ACA ribonucleoprotein complex subunit 1 OS=Rattus norvegicus GN=Gar1 PE=2 SV=1 20 118 3.0E-24
sp|Q61B10|GAR1_CAEBR Probable H/ACA ribonucleoprotein complex subunit 1-like protein OS=Caenorhabditis briggsae GN=CBG13541 PE=3 SV=1 24 117 3.0E-24
sp|Q9TYK1|GAR1_CAEEL Probable H/ACA ribonucleoprotein complex subunit 1-like protein OS=Caenorhabditis elegans GN=Y66H1A.4 PE=3 SV=2 24 117 1.0E-21
sp|Q7KVQ0|GAR1_DROME Probable H/ACA ribonucleoprotein complex subunit 1 OS=Drosophila melanogaster GN=CG4038 PE=2 SV=1 23 118 9.0E-21
sp|Q54XE6|GAR1_DICDI Probable H/ACA ribonucleoprotein complex subunit 1 OS=Dictyostelium discoideum GN=gar1 PE=3 SV=1 28 119 7.0E-20
sp|O96722|GAR1_ENCCU H/ACA ribonucleoprotein complex subunit 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=GAR1 PE=3 SV=2 27 180 9.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0042254 ribosome biogenesis Yes
GO:0001522 pseudouridine synthesis Yes
GO:0071840 cellular component organization or biogenesis No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0009451 RNA modification No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044085 cellular component biogenesis No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2856
MSLRGRGGGRGGFRGGRGGFAPAGPPAEVLEMGLFKHAVEGEILCQSSNVKVPFFNAPIYLENKTPIGKVDEILG
PINEVYFTIKPQEGIVASSFKEGDKFYIGGDKLLPLEKFLPKPKVLGEAKVKKPGGARGGRGGGRGGRGGRGGRG
GGRGAPGGFSGGFSRGGSRGGGGFSRGGGRGAGGFSRGGGGGRGGFGGGYRGRGRG*
Coding >OphauG2|2856
ATGTCGCTTAGAGGCCGTGGCGGCGGCCGCGGCGGCTTTCGAGGTGGACGAGGCGGCTTTGCACCCGCGGGACCC
CCTGCCGAAGTGTTGGAAATGGGCTTGTTCAAGCACGCCGTCGAAGGCGAGATACTCTGCCAGTCGTCCAACGTC
AAAGTTCCCTTTTTCAATGCGCCCATATACCTCGAGAACAAGACTCCTATTGGCAAGGTTGACGAGATTCTCGGC
CCCATCAACGAGGTATACTTTACCATTAAGCCACAAGAAGGCATCGTTGCCTCAAGCTTTAAGGAGGGCGACAAG
TTCTATATTGGAGGCGACAAGCTACTGCCCCTGGAAAAGTTTCTGCCCAAGCCAAAGGTCCTGGGGGAAGCAAAG
GTCAAGAAACCTGGCGGAGCGCGCGGTGGACGTGGGGGTGGCAGGGGAGGGAGAGGAGGAAGAGGAGGCCGCGGT
GGTGGACGAGGAGCACCGGGTGGCTTCTCGGGTGGCTTCTCGAGGGGCGGTTCCCGGGGCGGGGGCGGCTTCTCA
CGAGGGGGCGGCCGCGGCGCAGGGGGTTTTTCCAGAGGAGGGGGAGGCGGTCGGGGTGGCTTTGGTGGCGGCTAC
AGAGGACGGGGGAGAGGATAG
Transcript >OphauG2|2856
ATGTCGCTTAGAGGCCGTGGCGGCGGCCGCGGCGGCTTTCGAGGTGGACGAGGCGGCTTTGCACCCGCGGGACCC
CCTGCCGAAGTGTTGGAAATGGGCTTGTTCAAGCACGCCGTCGAAGGCGAGATACTCTGCCAGTCGTCCAACGTC
AAAGTTCCCTTTTTCAATGCGCCCATATACCTCGAGAACAAGACTCCTATTGGCAAGGTTGACGAGATTCTCGGC
CCCATCAACGAGGTATACTTTACCATTAAGCCACAAGAAGGCATCGTTGCCTCAAGCTTTAAGGAGGGCGACAAG
TTCTATATTGGAGGCGACAAGCTACTGCCCCTGGAAAAGTTTCTGCCCAAGCCAAAGGTCCTGGGGGAAGCAAAG
GTCAAGAAACCTGGCGGAGCGCGCGGTGGACGTGGGGGTGGCAGGGGAGGGAGAGGAGGAAGAGGAGGCCGCGGT
GGTGGACGAGGAGCACCGGGTGGCTTCTCGGGTGGCTTCTCGAGGGGCGGTTCCCGGGGCGGGGGCGGCTTCTCA
CGAGGGGGCGGCCGCGGCGCAGGGGGTTTTTCCAGAGGAGGGGGAGGCGGTCGGGGTGGCTTTGGTGGCGGCTAC
AGAGGACGGGGGAGAGGATAG
Gene >OphauG2|2856
ATGTCGCTTAGAGGCCGTGGCGGCGGCCGCGGCGGCTTTCGAGGTCCGTTTGCCTGTCAATGGCACCCTCCAACA
GCTACTAACAATAACCAGGTGGACGAGGCGGCTTTGCACCCGCGGGACCCCCTGCCGAAGTGTTGGAAATGGGCT
TGTTCAAGCACGCCGTCGAAGGCGAGATACTCTGCCAGTCGTCCAACGTCAAAGTTCCCTTTTTCAATGCGCCCA
TATACCTCGAGAACAAGACTCCTATTGGCAAGGTTGACGAGATTCTCGGCCCCATCAACGAGGTATACTTTACCA
TTAAGCCACAAGAAGGCATCGTTGCCTCAAGCTTTAAGGAGGGCGACAAGTTCTATATTGGAGGCGACAAGCTAC
TGCCCCTGGAAAAGTTTCTGCCCAAGCCAAAGGTCCTGGGGGAAGCAAAGGTCAAGAAACCTGGCGGAGCGCGCG
GTGGACGTGGGGGTGGCAGGGGAGGGAGAGGAGGAAGAGGAGGCCGCGGTGGTGGACGAGGAGCACCGGGTGGCT
TCTCGGGTGGCTTCTCGAGGGGCGGTTCCCGGGGCGGGGGCGGCTTCTCACGAGGGGGCGGCCGCGGCGCAGGGG
GTTTTTCCAGAGGAGGGGGAGGCGGTCGGGGTGGCTTTGGTGGCGGCTACAGAGGACGGGGGAGAGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail