Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2851
Gene name
LocationContig_21:34612..35506
Strand-
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.3E-21 37 293
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 1.1E-13 39 232

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9FD10|SSEJ_SALTY Secreted effector protein SseJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sseJ PE=1 SV=1 19 290 9.0E-16
sp|Q99289|HLT_VIBPA Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0226 PE=1 SV=2 35 295 1.0E-15
sp|P10480|GCAT_AERHY Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila PE=1 SV=3 35 263 1.0E-11
sp|Q9FJ41|GDL85_ARATH GDSL esterase/lipase At5g45950 OS=Arabidopsis thaliana GN=At5g45950 PE=2 SV=1 15 292 2.0E-09

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2851
MAGLSLSRAAVATLSVLSLGAALPTRQEAALANASALVVFGDSYTDNGNAYALTNDTWPADPAYFQGRFSNGPVW
SEQLAQQKSLTLHDYAYASATTSNRISKGTTGSNADIRVPSLDEQVERYLARLPAPASQSILVLWGGTNDPLFNS
TIAPQASAQVMRGLVHRLKSVSPAGMLIIGIPDLSLLPYGYFIDAEEQDRLHAFSVEYNIELSRIAKQAGAKYVD
VSSLLQSFEYYGKGWQGVGLDAFGFYGSCLEGAYMEAPKRKCEDPEKRVYWDEYHVTRRVHELFAEKIAEVL*
Coding >OphauG2|2851
ATGGCTGGCCTTTCGCTATCTAGAGCCGCAGTGGCGACGCTGTCGGTCCTGTCACTTGGCGCAGCGCTGCCAACG
CGACAAGAGGCTGCCCTGGCGAATGCTTCTGCCCTTGTCGTCTTTGGCGACTCATACACTGACAACGGCAACGCC
TATGCCCTGACCAATGATACATGGCCTGCAGATCCGGCCTACTTCCAGGGCCGCTTCTCCAACGGGCCCGTATGG
TCAGAACAGCTCGCCCAACAGAAATCGCTTACGCTCCATGACTATGCATACGCCAGCGCAACAACATCCAACCGC
ATCAGCAAGGGCACCACGGGCTCCAACGCTGATATCCGCGTGCCGTCTCTCGACGAGCAGGTTGAGAGATATCTC
GCCAGGCTGCCCGCGCCAGCATCACAGTCGATTCTCGTTCTCTGGGGCGGCACCAACGACCCGCTCTTCAACTCG
ACCATTGCGCCGCAGGCCTCTGCCCAAGTCATGCGCGGGCTAGTCCATCGTTTAAAGAGCGTGAGCCCGGCGGGG
ATGCTGATTATCGGGATTCCGGACTTGTCCTTGCTGCCATATGGCTATTTCATAGACGCCGAGGAGCAGGACAGG
CTGCACGCTTTTTCGGTGGAGTATAACATCGAGCTGAGCAGGATAGCAAAGCAGGCGGGAGCAAAGTACGTCGAC
GTGAGTTCGCTACTGCAGAGTTTCGAGTATTATGGAAAAGGATGGCAGGGCGTGGGGCTGGATGCGTTTGGGTTT
TATGGGAGTTGTTTGGAGGGCGCGTATATGGAGGCGCCGAAGCGGAAGTGTGAGGATCCGGAGAAGAGGGTATAT
TGGGATGAGTACCATGTTACGAGGAGGGTGCATGAGTTGTTTGCGGAGAAGATTGCAGAGGTCTTGTAG
Transcript >OphauG2|2851
ATGGCTGGCCTTTCGCTATCTAGAGCCGCAGTGGCGACGCTGTCGGTCCTGTCACTTGGCGCAGCGCTGCCAACG
CGACAAGAGGCTGCCCTGGCGAATGCTTCTGCCCTTGTCGTCTTTGGCGACTCATACACTGACAACGGCAACGCC
TATGCCCTGACCAATGATACATGGCCTGCAGATCCGGCCTACTTCCAGGGCCGCTTCTCCAACGGGCCCGTATGG
TCAGAACAGCTCGCCCAACAGAAATCGCTTACGCTCCATGACTATGCATACGCCAGCGCAACAACATCCAACCGC
ATCAGCAAGGGCACCACGGGCTCCAACGCTGATATCCGCGTGCCGTCTCTCGACGAGCAGGTTGAGAGATATCTC
GCCAGGCTGCCCGCGCCAGCATCACAGTCGATTCTCGTTCTCTGGGGCGGCACCAACGACCCGCTCTTCAACTCG
ACCATTGCGCCGCAGGCCTCTGCCCAAGTCATGCGCGGGCTAGTCCATCGTTTAAAGAGCGTGAGCCCGGCGGGG
ATGCTGATTATCGGGATTCCGGACTTGTCCTTGCTGCCATATGGCTATTTCATAGACGCCGAGGAGCAGGACAGG
CTGCACGCTTTTTCGGTGGAGTATAACATCGAGCTGAGCAGGATAGCAAAGCAGGCGGGAGCAAAGTACGTCGAC
GTGAGTTCGCTACTGCAGAGTTTCGAGTATTATGGAAAAGGATGGCAGGGCGTGGGGCTGGATGCGTTTGGGTTT
TATGGGAGTTGTTTGGAGGGCGCGTATATGGAGGCGCCGAAGCGGAAGTGTGAGGATCCGGAGAAGAGGGTATAT
TGGGATGAGTACCATGTTACGAGGAGGGTGCATGAGTTGTTTGCGGAGAAGATTGCAGAGGTCTTGTAG
Gene >OphauG2|2851
ATGGCTGGCCTTTCGCTATCTAGAGCCGCAGTGGCGACGCTGTCGGTCCTGTCACTTGGCGCAGCGCTGCCAACG
CGACAAGAGGCTGCCCTGGCGAATGCTTCTGCCCTTGTCGTCTTTGGCGACTCATACACTGACAACGGCAACGCC
TATGCCCTGACCAATGATACATGGCCTGCAGATCCGGCCTACTTCCAGGGCCGCTTCTCCAACGGGCCCGTATGG
TCAGAACAGCTCGCCCAACAGAAATCGCTTACGCTCCATGACTATGCATACGCCAGCGCAACAACATCCAACCGC
ATCAGCAAGGGCACCACGGGCTCCAACGCTGATATCCGCGTGCCGTCTCTCGACGAGCAGGTTGAGAGATATCTC
GCCAGGCTGCCCGCGCCAGCATCACAGTCGATTCTCGTTCTCTGGGGCGGCACCAACGACCCGCTCTTCAACTCG
ACCATTGCGCCGCAGGCCTCTGCCCAAGTCATGCGCGGGCTAGTCCATCGTTTAAAGAGCGTGAGCCCGGCGGGG
ATGCTGATTATCGGGATTCCGGACTTGTCCTTGCTGCCATATGGCTATTTCATAGACGCCGAGGAGCAGGACAGG
CTGCACGCTTTTTCGGTGGAGTATAACATCGAGCTGAGCAGGATAGCAAAGCAGGCGGGAGCAAAGTACGTCGAC
GTGAGTTCGCTACTGCAGAGTTTCGAGTATTATGGAAAAGGATGGCAGGGCGTGGGGCTGGATGCGTTTGGGTTT
TATGGGAGTTGTTTGGAGGGCGCGTATATGGAGGCGCCGAAGCGGAAGTGTGAGGATCCGGAGAAGAGGGTATAT
TGGGATGAGTACCATGTTACGAGGAGGGTGCATGAGTTGTTTGCGGAGAAGATTGCAGAGGTCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail