Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2836
Gene name
LocationContig_209:14063..15406
Strand-
Gene length (bp)1343
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q28298|RRBP1_CANLF Ribosome-binding protein 1 OS=Canis lupus familiaris GN=RRBP1 PE=2 SV=1 136 240 3.0E-07
sp|Q86VQ3|TXND2_HUMAN Thioredoxin domain-containing protein 2 OS=Homo sapiens GN=TXNDC2 PE=2 SV=4 119 370 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2836
MRSLTTLVLSFLLASDAVLAAPQAPPPPPPPEPPLASLGRTFSLTAKRMDNFKPNGAMAMALAYSKYSKPMPPGL
MSMLNDMGVKMAPRHSKRAEETTGKEGDKEGEEGGKEGGKEGKEGGKEGEEGGKEGEEGSKPEEGGKPEGEPKEG
EPKEGEPKEGEPKEGEPKEGEPKEGEPEEGEPKEGEPKEGEPKEGEPKEGEPKKGKPEEEEPKEGKPEEEEPKEG
EPKEGEPKEGEPKEGXXXXXXXXXXXXXXXXXXXXXXKEGEPKEGEPKEGEPKEGGEPKEGGKGCKPKEGGKPKA
VKPEEGGESCDPEEGGKEREGSKPGEAEPKEGGEGCKPKEGGKPEEEEGGEGCKPKEGGEPEEEEPKEGEPKEGE
PKEGGKEGEKGGEKGGEKEGEKGEPKGGR*
Coding >OphauG2|2836
ATGCGTTCTCTTACCACCCTCGTCTTATCCTTTCTCCTGGCCAGTGATGCTGTGCTCGCTGCGCCCCAGGCTCCT
CCGCCGCCGCCTCCGCCGGAGCCTCCACTCGCCAGCTTGGGTCGAACCTTTAGCCTCACTGCCAAGCGCATGGAT
AACTTCAAGCCCAACGGTGCAATGGCCATGGCTCTTGCTTATTCGAAGTACAGCAAGCCTATGCCTCCCGGGCTG
ATGTCGATGCTTAATGACATGGGCGTTAAAATGGCTCCTCGGCATTCCAAACGCGCTGAAGAAACGACAGGCAAA
GAGGGGGATAAAGAGGGCGAAGAGGGAGGCAAAGAGGGCGGTAAAGAGGGCAAAGAGGGCGGCAAAGAGGGCGAA
GAGGGAGGCAAAGAGGGCGAAGAGGGCAGCAAGCCGGAAGAAGGAGGAAAACCTGAAGGAGAGCCTAAGGAAGGA
GAACCTAAGGAAGGCGAACCCAAGGAGGGAGAGCCCAAGGAAGGCGAACCTAAGGAAGGCGAACCTAAGGAAGGC
GAACCCGAGGAAGGCGAACCCAAGGAAGGAGAACCCAAGGAGGGAGAGCCTAAGGAAGGAGAGCCTAAGGAGGGA
GAGCCTAAGAAAGGAAAACCCGAGGAAGAAGAACCCAAGGAAGGAAAACCCGAGGAAGAAGAACCCAAGGAAGGC
GAACCCAAGGAAGGCGAACCCAAGGAAGGAGAACCCAAGGAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGGAAGGAGAGCCTAAGGAAGGAGAACCCAAGGAAGGA
GAGCCTAAGGAAGGCGGCGAGCCCAAGGAGGGAGGCAAAGGATGCAAACCCAAAGAAGGCGGCAAGCCTAAAGCT
GTCAAACCCGAAGAGGGCGGCGAATCATGCGACCCCGAAGAAGGCGGCAAAGAAAGAGAGGGCAGCAAGCCTGGA
GAAGCCGAACCTAAGGAGGGCGGCGAAGGATGCAAGCCTAAAGAAGGAGGAAAACCCGAAGAAGAAGAGGGGGGC
GAAGGATGCAAGCCAAAGGAAGGAGGAGAACCCGAGGAAGAAGAACCCAAGGAGGGAGAACCTAAGGAAGGAGAA
CCCAAGGAAGGAGGCAAAGAGGGTGAGAAAGGCGGCGAGAAAGGCGGTGAGAAAGAAGGAGAGAAAGGCGAGCCT
AAAGGAGGGAGGTGA
Transcript >OphauG2|2836
ATGCGTTCTCTTACCACCCTCGTCTTATCCTTTCTCCTGGCCAGTGATGCTGTGCTCGCTGCGCCCCAGGCTCCT
CCGCCGCCGCCTCCGCCGGAGCCTCCACTCGCCAGCTTGGGTCGAACCTTTAGCCTCACTGCCAAGCGCATGGAT
AACTTCAAGCCCAACGGTGCAATGGCCATGGCTCTTGCTTATTCGAAGTACAGCAAGCCTATGCCTCCCGGGCTG
ATGTCGATGCTTAATGACATGGGCGTTAAAATGGCTCCTCGGCATTCCAAACGCGCTGAAGAAACGACAGGCAAA
GAGGGGGATAAAGAGGGCGAAGAGGGAGGCAAAGAGGGCGGTAAAGAGGGCAAAGAGGGCGGCAAAGAGGGCGAA
GAGGGAGGCAAAGAGGGCGAAGAGGGCAGCAAGCCGGAAGAAGGAGGAAAACCTGAAGGAGAGCCTAAGGAAGGA
GAACCTAAGGAAGGCGAACCCAAGGAGGGAGAGCCCAAGGAAGGCGAACCTAAGGAAGGCGAACCTAAGGAAGGC
GAACCCGAGGAAGGCGAACCCAAGGAAGGAGAACCCAAGGAGGGAGAGCCTAAGGAAGGAGAGCCTAAGGAGGGA
GAGCCTAAGAAAGGAAAACCCGAGGAAGAAGAACCCAAGGAAGGAAAACCCGAGGAAGAAGAACCCAAGGAAGGC
GAACCCAAGGAAGGCGAACCCAAGGAAGGAGAACCCAAGGAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGGAAGGAGAGCCTAAGGAAGGAGAACCCAAGGAAGGA
GAGCCTAAGGAAGGCGGCGAGCCCAAGGAGGGAGGCAAAGGATGCAAACCCAAAGAAGGCGGCAAGCCTAAAGCT
GTCAAACCCGAAGAGGGCGGCGAATCATGCGACCCCGAAGAAGGCGGCAAAGAAAGAGAGGGCAGCAAGCCTGGA
GAAGCCGAACCTAAGGAGGGCGGCGAAGGATGCAAGCCTAAAGAAGGAGGAAAACCCGAAGAAGAAGAGGGGGGC
GAAGGATGCAAGCCAAAGGAAGGAGGAGAACCCGAGGAAGAAGAACCCAAGGAGGGAGAACCTAAGGAAGGAGAA
CCCAAGGAAGGAGGCAAAGAGGGTGAGAAAGGCGGCGAGAAAGGCGGTGAGAAAGAAGGAGAGAAAGGCGAGCCT
AAAGGAGGGAGGTGA
Gene >OphauG2|2836
ATGCGTTCTCTTACCACCCTCGTCTTATCCTTTCTCCTGGCCAGTGATGCTGTGCTCGCTGCGCCCCAGGCTCCT
CCGCCGCCGCCTCCGCCGGAGCCTCCACTCGCCAGCTTGGGTCGAACCTTTAGCCTCACTGCCAAGCGCATGGAT
AACTTCAAGCCCAACGGTGCAATGGCCATGGCTCTTGCTTATTCGAAGTACAGCAAGCCTATGCCTCCCGGGCTG
ATGTCGATGCTTAATGACATGGGCGTTAAAATGGCTCCTCGGCATTCCAAACGCGCTGAAGAAACGACAGGCAAA
GAGGGGGATAAAGAGGGCGAAGAGGGAGGCAAAGAGGGCGGTAAAGAGGGCAAAGAGGGCGGCAAAGAGGGCGAA
GAGGGAGGCAAAGAGGGCGAAGAGGGCAGCAAGCCGGAAGAAGGAGGAAAACCTGAAGGAGAGCCTAAGGAAGGA
GAACCTAAGGAAGGCGAACCCAAGGAGGGAGAGCCCAAGGAAGGCGAACCTAAGGAAGGCGAACCTAAGGAAGGC
GAACCCGAGGAAGGCGAACCCAAGGAAGGAGAACCCAAGGAGGGAGAGCCTAAGGAAGGAGAGCCTAAGGAGGGA
GAGCCTAAGAAAGGAAAACCCGAGGAAGAAGAACCCAAGGAAGGAAAACCCGAGGAAGAAGAACCCAAGGAAGGC
GAACCCAAGGAAGGCGAACCCAAGGAAGGAGAACCCAAGGAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGGAAGGAGAGCCTAAGGAAGGAGAACCCAAGGAAGGA
GAGCCTAAGGAAGGCGGCGAGCCCAAGGAGGGAGGCAAAGGATGCAAACCCAAAGAAGGCGGCAAGCCTAAAGCT
GTCAAACCCGAAGAGGGCGGCGAATCATGCGACCCCGAAGAAGGCGGCAAAGAAAGAGAGGGCAGCAAGCCTGGA
GAAGCCGAACCTAAGGAGGGCGGCGAAGGATGCAAGCCTAAAGAAGGAGGAAAACCCGAAGAAGAAGAGGGGGGC
GAAGGATGCAAGCCAAAGGAAGGAGGAGAACCCGAGGAAGAAGAACCCAAGGAGGGAGAACCTAAGGAAGGAGAA
CCCAAGGAAGGAGGCAAAGAGGGTGAGAAAGGCGGCGAGAAAGGCGGTGAGAAAGAAGGAGAGAAAGGCGAGCCT
AAAGGAGGTAAGGAAGGCAAAGAGTGTGGAAAAGAGGGAGGCAAAGAGGGGGGGGAAGGTAGTAAAGAAGGCGGC
AAAGAAGGTAAGGAGTGCAGCAAGAAGGGGGGAAAAGAGGGAGGCATGGAGGGCGAAAAGGGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail