Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2822
Gene name
LocationContig_208:21007..22217
Strand-
Gene length (bp)1210
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 1.3E-12 168 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GQ26|SRBP2_XENLA Sterol regulatory element-binding protein 2 OS=Xenopus laevis GN=srebf2 PE=2 SV=1 152 228 7.0E-08
sp|O97676|SRBP1_PIG Sterol regulatory element-binding protein 1 OS=Sus scrofa GN=SREBF1 PE=2 SV=2 153 228 2.0E-07
sp|P56720|SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus GN=Srebf1 PE=1 SV=3 156 245 2.0E-07
sp|A3KNA7|SRBP2_DANRE Sterol regulatory element-binding protein 2 OS=Danio rerio GN=srebf2 PE=2 SV=1 135 228 2.0E-07
sp|Q9WTN3|SRBP1_MOUSE Sterol regulatory element-binding protein 1 OS=Mus musculus GN=Srebf1 PE=1 SV=4 168 245 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GQ26|SRBP2_XENLA Sterol regulatory element-binding protein 2 OS=Xenopus laevis GN=srebf2 PE=2 SV=1 152 228 7.0E-08
sp|O97676|SRBP1_PIG Sterol regulatory element-binding protein 1 OS=Sus scrofa GN=SREBF1 PE=2 SV=2 153 228 2.0E-07
sp|P56720|SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus GN=Srebf1 PE=1 SV=3 156 245 2.0E-07
sp|A3KNA7|SRBP2_DANRE Sterol regulatory element-binding protein 2 OS=Danio rerio GN=srebf2 PE=2 SV=1 135 228 2.0E-07
sp|Q9WTN3|SRBP1_MOUSE Sterol regulatory element-binding protein 1 OS=Mus musculus GN=Srebf1 PE=1 SV=4 168 245 2.0E-07
sp|Q60429|SRBP2_CRIGR Sterol regulatory element-binding protein 2 OS=Cricetulus griseus GN=SREBF2 PE=2 SV=1 152 228 3.0E-07
sp|Q3T1I5|SRBP2_RAT Sterol regulatory element-binding protein 2 OS=Rattus norvegicus GN=Srebf2 PE=2 SV=1 168 228 3.0E-07
sp|Q3U1N2|SRBP2_MOUSE Sterol regulatory element-binding protein 2 OS=Mus musculus GN=Srebf2 PE=1 SV=2 168 228 3.0E-07
sp|Q12772|SRBP2_HUMAN Sterol regulatory element-binding protein 2 OS=Homo sapiens GN=SREBF2 PE=1 SV=2 152 228 3.0E-07
sp|Q60416|SRBP1_CRIGR Sterol regulatory element-binding protein 1 OS=Cricetulus griseus GN=SREBF1 PE=2 SV=1 168 228 2.0E-06
sp|P36956|SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens GN=SREBF1 PE=1 SV=2 151 228 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2822
MPRPTYPPTPGSSTDIKARDGVLQLSSLHLSFELPPPALHHDASSTSCALPSSNPCSISNSSRHSSSTYTPSLPA
MQVTKQRRRPLRGVKEETFSLPPPPTRSRKIIQMKPRAYEEAAAQSLSAKTGEGAKGAVGASRAVSGASSAGDKG
GKKKPGNVTSAAGRKIARKTAHSLIERRRRSKMNEEFGVLKNMIPACTGEMHKLAILQASIEYIRYLEECVDKLK
AQHTDSQSRHDTGTQHQLPSIRDFHPTLHDDVEMTDSDTASHLFIDQTDQHRQPLSSASPPQQRQPSPSSAGLST
TFKHYTYSASATTSPVFTANQSGGASYRVSHALAESVLPSPTMKPHGDLDQEATAALMMLNHSKRTNSSGGRGLS
VRDLVTT*
Coding >OphauG2|2822
ATGCCCCGGCCAACCTATCCTCCGACCCCTGGGTCTTCTACAGATATCAAGGCCCGCGACGGCGTCTTACAGCTC
TCTTCTCTTCACTTGTCCTTTGAACTGCCGCCTCCCGCACTGCACCACGATGCCTCGTCAACATCGTGCGCTTTA
CCATCCTCAAACCCTTGCAGCATCAGCAACAGCTCACGGCATTCTTCAAGCACCTATACGCCCTCGTTGCCAGCC
ATGCAGGTTACCAAGCAGCGTCGCCGGCCCTTGCGAGGTGTCAAAGAGGAGACCTTTTCTCTGCCTCCGCCCCCG
ACTCGCTCCCGTAAAATCATACAGATGAAGCCCCGTGCCTATGAAGAGGCTGCTGCACAGAGCCTCTCCGCCAAG
ACGGGCGAGGGTGCCAAGGGAGCCGTCGGGGCCAGCAGGGCTGTCTCTGGAGCGTCGTCGGCAGGAGATAAAGGT
GGTAAGAAAAAGCCGGGCAATGTGACAAGCGCGGCCGGGCGCAAGATAGCAAGAAAGACGGCACATAGCCTCATC
GAGAGGCGGCGGCGCAGCAAAATGAATGAAGAGTTTGGCGTTCTCAAGAACATGATTCCCGCTTGCACGGGCGAG
ATGCACAAGCTCGCCATTCTTCAGGCGTCGATTGAATATATTCGATATCTCGAGGAATGCGTCGACAAACTCAAA
GCTCAGCACACCGACAGCCAGAGTCGCCACGATACGGGCACACAGCACCAGCTGCCCTCAATTCGCGACTTCCAT
CCCACGCTGCATGACGACGTTGAAATGACCGACTCGGACACGGCGTCGCACCTCTTCATTGACCAGACGGACCAG
CACAGACAGCCACTATCCTCGGCCTCACCTCCTCAGCAGCGACAGCCCTCTCCATCGTCAGCGGGCTTGTCAACA
ACCTTTAAGCATTATACCTATAGCGCCTCGGCCACCACTTCGCCCGTATTTACAGCCAACCAATCAGGAGGCGCC
AGTTATAGAGTAAGCCATGCATTGGCCGAATCGGTCCTGCCTAGTCCTACCATGAAGCCGCATGGCGACCTTGAC
CAGGAGGCCACAGCAGCACTCATGATGCTCAACCACAGCAAGCGAACCAATAGCAGCGGTGGACGAGGTTTGTCG
GTCCGTGATTTGGTAACCACATGA
Transcript >OphauG2|2822
ATGCCCCGGCCAACCTATCCTCCGACCCCTGGGTCTTCTACAGATATCAAGGCCCGCGACGGCGTCTTACAGCTC
TCTTCTCTTCACTTGTCCTTTGAACTGCCGCCTCCCGCACTGCACCACGATGCCTCGTCAACATCGTGCGCTTTA
CCATCCTCAAACCCTTGCAGCATCAGCAACAGCTCACGGCATTCTTCAAGCACCTATACGCCCTCGTTGCCAGCC
ATGCAGGTTACCAAGCAGCGTCGCCGGCCCTTGCGAGGTGTCAAAGAGGAGACCTTTTCTCTGCCTCCGCCCCCG
ACTCGCTCCCGTAAAATCATACAGATGAAGCCCCGTGCCTATGAAGAGGCTGCTGCACAGAGCCTCTCCGCCAAG
ACGGGCGAGGGTGCCAAGGGAGCCGTCGGGGCCAGCAGGGCTGTCTCTGGAGCGTCGTCGGCAGGAGATAAAGGT
GGTAAGAAAAAGCCGGGCAATGTGACAAGCGCGGCCGGGCGCAAGATAGCAAGAAAGACGGCACATAGCCTCATC
GAGAGGCGGCGGCGCAGCAAAATGAATGAAGAGTTTGGCGTTCTCAAGAACATGATTCCCGCTTGCACGGGCGAG
ATGCACAAGCTCGCCATTCTTCAGGCGTCGATTGAATATATTCGATATCTCGAGGAATGCGTCGACAAACTCAAA
GCTCAGCACACCGACAGCCAGAGTCGCCACGATACGGGCACACAGCACCAGCTGCCCTCAATTCGCGACTTCCAT
CCCACGCTGCATGACGACGTTGAAATGACCGACTCGGACACGGCGTCGCACCTCTTCATTGACCAGACGGACCAG
CACAGACAGCCACTATCCTCGGCCTCACCTCCTCAGCAGCGACAGCCCTCTCCATCGTCAGCGGGCTTGTCAACA
ACCTTTAAGCATTATACCTATAGCGCCTCGGCCACCACTTCGCCCGTATTTACAGCCAACCAATCAGGAGGCGCC
AGTTATAGAGTAAGCCATGCATTGGCCGAATCGGTCCTGCCTAGTCCTACCATGAAGCCGCATGGCGACCTTGAC
CAGGAGGCCACAGCAGCACTCATGATGCTCAACCACAGCAAGCGAACCAATAGCAGCGGTGGACGAGGTTTGTCG
GTCCGTGATTTGGTAACCACATGA
Gene >OphauG2|2822
ATGCCCCGGCCAACCTATCCTCCGACCCCTGGGTCTTCTACAGATATCAAGGCCCGCGACGGCGTCTTACAGCTC
TCTTCTCTTCACTTGTCCTTTGAACTGCCGCCTCCCGCACTGCACCACGATGCCTCGTCAACATCGTGCGCTTTA
CCATCCTCAAACCCTTGCAGCATCAGCAACAGCTCACGGCATTCTTCAAGCACCTATACGCCCTCGTTGCCAGCC
ATGCAGGTTACCAAGCAGCGTCGCCGGCCCTTGCGAGGTGTCAAAGAGGAGACCTTTTCTCTGCCTCCGCCCCCG
ACTCGCTCCCGTAAAATCATACAGATGAAGCCCCGTGCCTATGAAGAGGCTGCTGCACAGAGCCTCTCCGCCAAG
ACGGGCGAGGGTGCCAAGGGAGCCGTCGGGGCCAGCAGGGCTGTCTCTGGAGCGTCGTCGGCAGGAGATAAAGGT
GGTAAGAAAAAGCCGGGCAATGTGACAAGCGCGGCCGGGCGCAAGATAGCAAGAAAGACGGCACATAGCCTCATC
GAGAGGCGGCGGCGCAGCAAAATGAATGAAGAGTTTGGCGTTCTCAAGAACATGATTCCCGCTTGCACGGGCGAG
ATGCACAAGCTCGCCATTCTTCAGGTTCGACGCGCATGTCCCCTGACTGCTGGCACCCACCATGCTGACATGTTT
CTTGGGACAGGCGTCGATTGAATATATTCGATATCTCGAGGAATGCGTCGACAAACTCAAAGCTCAGCACACCGA
CAGCCAGAGTCGCCACGATACGGGCACACAGCACCAGCTGCCCTCAATTCGCGACTTCCATCCCACGCTGCATGA
CGACGTTGAAATGACCGACTCGGACACGGCGTCGCACCTCTTCATTGACCAGACGGACCAGCACAGACAGCCACT
ATCCTCGGCCTCACCTCCTCAGCAGCGACAGCCCTCTCCATCGTCAGCGGGCTTGTCAACAACCTTTAAGCATTA
TACCTATAGCGCCTCGGCCACCACTTCGCCCGTATTTACAGCCAACCAATCAGGAGGCGCCAGTTATAGAGTAAG
CCATGCATTGGCCGAATCGGTCCTGCCTAGTCCTACCATGAAGCCGCATGGCGACCTTGACCAGGAGGCCACAGC
AGCACTCATGATGCTCAACCACAGCAAGCGAACCAATAGCAGCGGTGGACGAGGTTTGTCGGTCCGTGATTTGGT
AACCACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail