Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2814
Gene name
LocationContig_208:5655..6431
Strand+
Gene length (bp)776
Transcript length (bp)705
Coding sequence length (bp)705
Protein length (aa) 235

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00677 Lum_binding Lumazine binding domain 2.1E-22 3 91
PF00677 Lum_binding Lumazine binding domain 3.5E-20 104 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7P0|RISA_SCHPO Riboflavin synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rib5 PE=1 SV=1 1 199 3.0E-72
sp|P38145|RISA_YEAST Riboflavin synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIB5 PE=1 SV=1 1 201 4.0E-63
sp|A5DB51|RISA_PICGU Riboflavin synthase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RIB5 PE=2 SV=3 1 201 1.0E-61
sp|P50854|RISA_ACTPL Riboflavin synthase OS=Actinobacillus pleuropneumoniae GN=ribE PE=3 SV=1 1 201 1.0E-49
sp|P16440|RISA_BACSU Riboflavin synthase OS=Bacillus subtilis (strain 168) GN=ribE PE=1 SV=2 1 201 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7P0|RISA_SCHPO Riboflavin synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rib5 PE=1 SV=1 1 199 3.0E-72
sp|P38145|RISA_YEAST Riboflavin synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIB5 PE=1 SV=1 1 201 4.0E-63
sp|A5DB51|RISA_PICGU Riboflavin synthase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RIB5 PE=2 SV=3 1 201 1.0E-61
sp|P50854|RISA_ACTPL Riboflavin synthase OS=Actinobacillus pleuropneumoniae GN=ribE PE=3 SV=1 1 201 1.0E-49
sp|P16440|RISA_BACSU Riboflavin synthase OS=Bacillus subtilis (strain 168) GN=ribE PE=1 SV=2 1 201 2.0E-43
sp|Q44680|RISA_BACAM Riboflavin synthase OS=Bacillus amyloliquefaciens GN=ribE PE=3 SV=1 1 201 3.0E-40
sp|O67604|RISA_AQUAE Riboflavin synthase OS=Aquifex aeolicus (strain VF5) GN=ribE PE=3 SV=1 1 197 2.0E-36
sp|P9WK35|RISA_MYCTU Riboflavin synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ribE PE=1 SV=1 1 199 3.0E-36
sp|P9WK34|RISA_MYCTO Riboflavin synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ribE PE=3 SV=1 1 199 3.0E-36
sp|P65328|RISA_MYCBO Riboflavin synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ribE PE=3 SV=1 1 199 3.0E-36
sp|P51961|RISA_PHOPO Riboflavin synthase OS=Photobacterium phosphoreum GN=ribE PE=3 SV=1 1 201 4.0E-36
sp|P0AFU9|RISA_SHIFL Riboflavin synthase OS=Shigella flexneri GN=ribE PE=3 SV=1 1 191 1.0E-34
sp|P45273|RISA_HAEIN Riboflavin synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ribE PE=3 SV=1 1 191 1.0E-34
sp|P0AFU8|RISA_ECOLI Riboflavin synthase OS=Escherichia coli (strain K12) GN=ribC PE=1 SV=1 1 191 1.0E-34
sp|P57212|RISA_BUCAI Riboflavin synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ribE PE=3 SV=1 1 195 1.0E-31
sp|Q9Z820|RISA_CHLPN Riboflavin synthase OS=Chlamydia pneumoniae GN=ribE PE=3 SV=1 1 209 9.0E-31
sp|Q89AX1|RISA_BUCBP Riboflavin synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ribE PE=3 SV=1 1 205 1.0E-28
sp|Q8KA22|RISA_BUCAP Riboflavin synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ribE PE=3 SV=1 1 195 2.0E-28
sp|Q01993|RISA_PHOLE Riboflavin synthase OS=Photobacterium leiognathi GN=ribE PE=3 SV=1 1 199 3.0E-27
sp|Q9PJZ1|RISA_CHLMU Riboflavin synthase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=ribE PE=3 SV=1 1 195 7.0E-24
sp|O84410|RISA_CHLTR Riboflavin synthase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=ribE PE=3 SV=1 1 195 8.0E-23
sp|P21578|LUXY_ALIFS Yellow fluorescent protein OS=Aliivibrio fischeri GN=luxY PE=1 SV=1 1 190 2.0E-14
sp|P25082|LUXP_PHOPO Lumazine protein OS=Photobacterium phosphoreum GN=luxL PE=1 SV=1 1 189 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4053
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2814 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7779
Ophiocordyceps camponoti-floridani Ophcf2|07358
Ophiocordyceps camponoti-rufipedis Ophun1|6573
Ophiocordyceps kimflemingae Ophio5|6654
Ophiocordyceps subramaniannii Hirsu2|8167

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2814
MFTGIVEQVGVISRIDKDASTGGTNFVVSLPSGSQLLQDCHQGDSIAVNGCCLTVTSFTSDSFKIGVAPETLRVT
NLSSLAQSSPVNLERAVRADTRMGGHFVQGHVDTTAEILSVTADGEALVFRFRPKMAEMLRYIIYKGFIAIDGTS
LTVTKVDDNQGWWEIMLIVYSQQRVILAQKKAGDTVNIEVDMMAKYAEKSLAGILGTEGGTASIPLLEKTVQRIV
AQGFGAKQS*
Coding >OphauG2|2814
ATGTTCACTGGCATAGTCGAACAAGTCGGCGTCATTTCTCGAATAGACAAGGACGCCTCCACGGGCGGCACCAAC
TTTGTCGTATCCCTTCCCTCGGGCTCACAGCTGCTCCAAGACTGCCACCAAGGCGACTCCATTGCCGTGAATGGC
TGCTGTCTCACCGTGACTTCCTTCACTTCTGACAGCTTCAAGATTGGCGTGGCACCCGAGACGCTGCGCGTCACC
AACCTGTCTTCTCTGGCCCAGTCTAGCCCCGTCAATCTTGAGCGTGCTGTCCGCGCCGACACGCGCATGGGCGGC
CATTTCGTCCAAGGTCATGTCGATACAACAGCCGAGATTCTGTCCGTCACTGCAGACGGGGAAGCCCTTGTTTTC
CGCTTCCGACCCAAGATGGCTGAAATGCTGCGGTACATCATCTACAAGGGCTTCATCGCCATTGATGGCACCAGT
CTCACTGTTACAAAAGTTGACGACAATCAAGGGTGGTGGGAAATCATGCTTATTGTCTACTCGCAGCAACGCGTC
ATTCTTGCCCAAAAAAAGGCAGGTGACACTGTCAACATTGAAGTCGACATGATGGCCAAGTACGCCGAGAAGTCG
TTGGCAGGAATTCTCGGGACAGAAGGCGGTACAGCCTCGATCCCCTTGTTGGAAAAGACGGTGCAGCGCATTGTT
GCGCAGGGCTTTGGTGCAAAGCAGTCTTGA
Transcript >OphauG2|2814
ATGTTCACTGGCATAGTCGAACAAGTCGGCGTCATTTCTCGAATAGACAAGGACGCCTCCACGGGCGGCACCAAC
TTTGTCGTATCCCTTCCCTCGGGCTCACAGCTGCTCCAAGACTGCCACCAAGGCGACTCCATTGCCGTGAATGGC
TGCTGTCTCACCGTGACTTCCTTCACTTCTGACAGCTTCAAGATTGGCGTGGCACCCGAGACGCTGCGCGTCACC
AACCTGTCTTCTCTGGCCCAGTCTAGCCCCGTCAATCTTGAGCGTGCTGTCCGCGCCGACACGCGCATGGGCGGC
CATTTCGTCCAAGGTCATGTCGATACAACAGCCGAGATTCTGTCCGTCACTGCAGACGGGGAAGCCCTTGTTTTC
CGCTTCCGACCCAAGATGGCTGAAATGCTGCGGTACATCATCTACAAGGGCTTCATCGCCATTGATGGCACCAGT
CTCACTGTTACAAAAGTTGACGACAATCAAGGGTGGTGGGAAATCATGCTTATTGTCTACTCGCAGCAACGCGTC
ATTCTTGCCCAAAAAAAGGCAGGTGACACTGTCAACATTGAAGTCGACATGATGGCCAAGTACGCCGAGAAGTCG
TTGGCAGGAATTCTCGGGACAGAAGGCGGTACAGCCTCGATCCCCTTGTTGGAAAAGACGGTGCAGCGCATTGTT
GCGCAGGGCTTTGGTGCAAAGCAGTCTTGA
Gene >OphauG2|2814
ATGTTCACTGGCATAGTCGAACAAGTCGGCGGTGAGTCTTGTAAAACTATTCAGCTGCTTCTGTCCACCACATCG
ATTTTTGGCTCACCCAGGGAGCCACAGTCATTTCTCGAATAGACAAGGACGCCTCCACGGGCGGCACCAACTTTG
TCGTATCCCTTCCCTCGGGCTCACAGCTGCTCCAAGACTGCCACCAAGGCGACTCCATTGCCGTGAATGGCTGCT
GTCTCACCGTGACTTCCTTCACTTCTGACAGCTTCAAGATTGGCGTGGCACCCGAGACGCTGCGCGTCACCAACC
TGTCTTCTCTGGCCCAGTCTAGCCCCGTCAATCTTGAGCGTGCTGTCCGCGCCGACACGCGCATGGGCGGCCATT
TCGTCCAAGGTCATGTCGATACAACAGCCGAGATTCTGTCCGTCACTGCAGACGGGGAAGCCCTTGTTTTCCGCT
TCCGACCCAAGATGGCTGAAATGCTGCGGTACATCATCTACAAGGGCTTCATCGCCATTGATGGCACCAGTCTCA
CTGTTACAAAAGTTGACGACAATCAAGGGTGGTGGGAAATCATGCTTATTGTCTACTCGCAGCAACGCGTCATTC
TTGCCCAAAAAAAGGCAGGTGACACTGTCAACATTGAAGTCGACATGATGGCCAAGTACGCCGAGAAGTCGTTGG
CAGGAATTCTCGGGACAGAAGGCGGTACAGCCTCGATCCCCTTGTTGGAAAAGACGGTGCAGCGCATTGTTGCGC
AGGGCTTTGGTGCAAAGCAGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail