Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2809
Gene name
LocationContig_2076:133..1259
Strand-
Gene length (bp)1126
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12204|YOR22_YEAST Probable phospholipase YOR022C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR022C PE=1 SV=1 204 294 3.0E-19
sp|P87109|YDK2_SCHPO Probable phospholipase C20G8.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.02 PE=3 SV=1 52 294 1.0E-14

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup800
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2809 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|4878
Ophiocordyceps australis map64 (Brazil) OphauB2|6337
Ophiocordyceps camponoti-floridani Ophcf2|02491
Ophiocordyceps camponoti-rufipedis Ophun1|4059
Ophiocordyceps kimflemingae Ophio5|473
Ophiocordyceps subramaniannii Hirsu2|349

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2809
MKPWLYQARSAQAIPKDTGSDVAAGSAQDAKPEPTTPKPAEGPTPPAAASTTAQPQLSTYRLFGSYMNNVATYQD
GTTAWLSSESMLSWVTSSVYERFAGGGYMSGVKLVRGYVEPTKAKEKEKEKDTGASDESQDVLGLDQRQQRILKR
RSAPPTTGEANETETVQVETQQSSLERQLSSLLSREGANPAEAEEEIRRREEQEIQDDYNAQAGEAQGREIEHLV
LVTHGIGQRLGVRMESINFVHDVNVLRKTLKGVYTNSADLKSLNTELGAGPGNCRVQVLPVCWRHLIDFPRRRQK
KGEHDLGEVAEDEDECLG*
Coding >OphauG2|2809
ATGAAACCATGGCTATATCAAGCCCGATCTGCCCAGGCGATACCCAAAGACACCGGCTCAGACGTCGCAGCCGGG
AGCGCCCAAGATGCCAAGCCTGAGCCAACCACTCCGAAACCAGCCGAGGGACCAACGCCTCCTGCAGCAGCATCA
ACGACGGCCCAGCCGCAGCTCTCTACATATAGGCTGTTTGGGTCATACATGAACAATGTTGCCACCTATCAGGAT
GGCACGACGGCGTGGCTTTCTTCGGAAAGTATGCTGTCGTGGGTCACTTCGTCTGTCTATGAGAGATTTGCTGGC
GGCGGATACATGAGTGGCGTCAAGCTGGTCAGAGGCTACGTCGAGCCGACCAAGGCCAAGGAAAAGGAAAAGGAA
AAGGATACAGGTGCCTCGGACGAATCCCAAGATGTACTGGGCTTGGATCAGCGCCAGCAAAGAATCTTGAAGCGA
AGATCGGCGCCTCCAACTACCGGTGAAGCCAACGAGACAGAAACGGTGCAAGTTGAGACTCAACAGTCAAGTCTT
GAGCGACAGCTCTCCTCCCTTCTCAGCAGAGAGGGCGCCAATCCAGCCGAAGCCGAAGAAGAAATCCGAAGGCGC
GAAGAACAGGAGATTCAAGACGATTACAATGCCCAGGCTGGCGAAGCGCAGGGCCGCGAGATTGAGCACTTGGTG
CTCGTAACACATGGAATCGGACAGCGTCTGGGCGTCAGGATGGAGAGCATCAACTTTGTCCACGACGTCAATGTG
CTGCGCAAAACGCTAAAGGGCGTCTACACAAACTCTGCCGATCTCAAGTCTCTCAACACGGAGCTCGGGGCTGGG
CCGGGAAATTGTCGCGTTCAAGTGTTGCCAGTGTGTTGGCGGCACTTGATTGATTTCCCTAGACGGCGGCAAAAG
AAGGGCGAGCACGATCTCGGAGAAGTGGCCGAGGATGAAGATGAATGCCTGGGCTGA
Transcript >OphauG2|2809
ATGAAACCATGGCTATATCAAGCCCGATCTGCCCAGGCGATACCCAAAGACACCGGCTCAGACGTCGCAGCCGGG
AGCGCCCAAGATGCCAAGCCTGAGCCAACCACTCCGAAACCAGCCGAGGGACCAACGCCTCCTGCAGCAGCATCA
ACGACGGCCCAGCCGCAGCTCTCTACATATAGGCTGTTTGGGTCATACATGAACAATGTTGCCACCTATCAGGAT
GGCACGACGGCGTGGCTTTCTTCGGAAAGTATGCTGTCGTGGGTCACTTCGTCTGTCTATGAGAGATTTGCTGGC
GGCGGATACATGAGTGGCGTCAAGCTGGTCAGAGGCTACGTCGAGCCGACCAAGGCCAAGGAAAAGGAAAAGGAA
AAGGATACAGGTGCCTCGGACGAATCCCAAGATGTACTGGGCTTGGATCAGCGCCAGCAAAGAATCTTGAAGCGA
AGATCGGCGCCTCCAACTACCGGTGAAGCCAACGAGACAGAAACGGTGCAAGTTGAGACTCAACAGTCAAGTCTT
GAGCGACAGCTCTCCTCCCTTCTCAGCAGAGAGGGCGCCAATCCAGCCGAAGCCGAAGAAGAAATCCGAAGGCGC
GAAGAACAGGAGATTCAAGACGATTACAATGCCCAGGCTGGCGAAGCGCAGGGCCGCGAGATTGAGCACTTGGTG
CTCGTAACACATGGAATCGGACAGCGTCTGGGCGTCAGGATGGAGAGCATCAACTTTGTCCACGACGTCAATGTG
CTGCGCAAAACGCTAAAGGGCGTCTACACAAACTCTGCCGATCTCAAGTCTCTCAACACGGAGCTCGGGGCTGGG
CCGGGAAATTGTCGCGTTCAAGTGTTGCCAGTGTGTTGGCGGCACTTGATTGATTTCCCTAGACGGCGGCAAAAG
AAGGGCGAGCACGATCTCGGAGAAGTGGCCGAGGATGAAGATGAATGCCTGGGCTGA
Gene >OphauG2|2809
ATGAAACCATGGCTATATCAAGCCCGATCTGCCCAGGCGATACCCAAAGACACCGGCTCAGACGTCGCAGCCGGG
AGCGCCCAAGATGCCAAGCCTGAGCCAACCACTCCGAAACCAGCCGAGGGACCAACGCCTCCTGCAGCAGCATCA
ACGACGGCCCAGCCGCAGCTCTCTACATATAGGCTGTTTGGGTCATACATGAACAATGTTGCCACCTATCAGGAT
GGCACGACGGCGTGGCTTTCTTCGGAAAGTATGCTGTCGTGGGTCACTTCGTCTGTCTATGAGAGATTTGCTGGC
GGCGGATACATGAGTGGCGTCAAGCTGGTCAGAGGCTACGTCGAGCCGACCAAGGCCAAGGAAAAGGAAAAGGAA
AAGGATACAGGTGCCTCGGACGAATCCCAAGATGTACTGGGCTTGGATCAGCGCCAGCAAAGAATCTTGAAGCGA
AGATCGGCGCCTCCAACTACCGGTGAAGCCAACGAGACAGAAACGGTGCAAGTTGAGACTCAACAGTCAAGTCTT
GAGCGACAGCTCTCCTCCCTTCTCAGCAGAGAGGGCGCCAATCCAGCCGAAGCCGAAGAAGAAATCCGAAGGCGC
GAAGAACAGGAGATTCAAGACGATTACAATGCCCAGGCTGGCGAAGCGCAGGGCCGCGAGATTGAGCACTTGGTG
CTCGTAACACATGGAATCGGACAGCGTCTGGGCGTCAGGTGCGCATAAAAAAAGAAAAAATAAAAGAAAAATAAA
CCCCCGCCCCCAAGAGCTTGGCTGATTCAAGACGGGGGGGGGGGGGAAAGAAAAGGATGTGAATGAGCTGACTAT
TGTATATCAGGATGGAGAGCATCAACTTTGTCCACGACGTCAATGTGCTGCGCAAAACGCTAAAGGGCGTCTACA
CAAACTCTGCCGATCTCAAGTCTCTCAACACGGAGCTCGGGGCTGGGCCGGGAAATTGTCGCGTTCAAGTGTTGC
CAGTGTGTTGGCGGCACTTGATTGATTTCCCTAGACGGCGGCAAAAGAAGGGCGAGCACGATCTCGGAGAAGTGG
CCGAGGATGAAGATGAATGTGAGTTTTCTTTTTTTTTTTTTTTCCTTTTTTTTTTAAAAAAAAAGGCCTGGGCTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail