Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2802
Gene name
LocationContig_207:6934..8611
Strand+
Gene length (bp)1677
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10602 RPN7 26S proteasome subunit RPN7 8.6E-45 97 272
PF01399 PCI PCI domain 8.5E-15 291 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BD89|CSN1_EMENI COP9 signalosome complex subunit 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnA PE=1 SV=2 19 437 1.0E-117
sp|Q7RXQ1|CSN1_NEUCR COP9 signalosome complex subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-1 PE=1 SV=1 39 430 1.0E-112
sp|Q99LD4|CSN1_MOUSE COP9 signalosome complex subunit 1 OS=Mus musculus GN=Gps1 PE=1 SV=1 13 432 2.0E-74
sp|P97834|CSN1_RAT COP9 signalosome complex subunit 1 OS=Rattus norvegicus GN=Gps1 PE=1 SV=1 13 432 3.0E-74
sp|Q6NRT5|CSN1_XENLA COP9 signalosome complex subunit 1 OS=Xenopus laevis GN=csn1 PE=2 SV=1 22 432 1.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BD89|CSN1_EMENI COP9 signalosome complex subunit 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnA PE=1 SV=2 19 437 1.0E-117
sp|Q7RXQ1|CSN1_NEUCR COP9 signalosome complex subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-1 PE=1 SV=1 39 430 1.0E-112
sp|Q99LD4|CSN1_MOUSE COP9 signalosome complex subunit 1 OS=Mus musculus GN=Gps1 PE=1 SV=1 13 432 2.0E-74
sp|P97834|CSN1_RAT COP9 signalosome complex subunit 1 OS=Rattus norvegicus GN=Gps1 PE=1 SV=1 13 432 3.0E-74
sp|Q6NRT5|CSN1_XENLA COP9 signalosome complex subunit 1 OS=Xenopus laevis GN=csn1 PE=2 SV=1 22 432 1.0E-72
sp|Q13098|CSN1_HUMAN COP9 signalosome complex subunit 1 OS=Homo sapiens GN=GPS1 PE=1 SV=4 13 432 9.0E-71
sp|P45432|CSN1_ARATH COP9 signalosome complex subunit 1 OS=Arabidopsis thaliana GN=CSN1 PE=1 SV=2 17 424 1.0E-68
sp|Q54QX3|CSN1_DICDI COP9 signalosome complex subunit 1 OS=Dictyostelium discoideum GN=csn1 PE=1 SV=1 27 437 7.0E-68
sp|Q9VVU5|CSN1_DROME COP9 signalosome complex subunit 1b OS=Drosophila melanogaster GN=CSN1b PE=2 SV=1 97 432 4.0E-64
sp|O94308|CSN1_SCHPO COP9 signalosome complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn1 PE=1 SV=1 20 391 5.0E-38
sp|Q9GS00|CSN1_CAEEL COP9 signalosome complex subunit 1 OS=Caenorhabditis elegans GN=csn-1 PE=1 SV=1 97 433 5.0E-29
sp|Q55C75|PSMD6_DICDI 26S proteasome non-ATPase regulatory subunit 6 OS=Dictyostelium discoideum GN=psmD6 PE=1 SV=1 96 423 7.0E-15
sp|Q8W425|PSMD6_ORYSJ 26S proteasome non-ATPase regulatory subunit 6 OS=Oryza sativa subsp. japonica GN=RPN7 PE=2 SV=1 111 397 1.0E-14
sp|Q93Y35|PSMD6_ARATH 26S proteasome non-ATPase regulatory subunit 6 homolog OS=Arabidopsis thaliana GN=RPN7 PE=1 SV=1 95 399 2.0E-12
sp|Q3T0B2|PSMD6_BOVIN 26S proteasome non-ATPase regulatory subunit 6 OS=Bos taurus GN=PSMD6 PE=2 SV=1 100 423 7.0E-11
sp|Q15008|PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens GN=PSMD6 PE=1 SV=1 100 423 2.0E-10
sp|Q20585|PSMD6_CAEEL 26S proteasome non-ATPase regulatory subunit 6 OS=Caenorhabditis elegans GN=rpn-7 PE=3 SV=1 96 399 2.0E-10
sp|Q99JI4|PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus GN=Psmd6 PE=1 SV=1 59 423 3.0E-10
sp|Q9V3G7|PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster GN=Rpn7 PE=2 SV=1 96 382 1.0E-09
sp|Q06103|RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN7 PE=1 SV=3 137 382 3.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3367
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2802 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|743
Ophiocordyceps camponoti-floridani Ophcf2|06011
Ophiocordyceps camponoti-rufipedis Ophun1|1588
Ophiocordyceps kimflemingae Ophio5|1011
Ophiocordyceps subramaniannii Hirsu2|626

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2802
MSASQAVHGFLQQFQPQRLILINEQPKFDLDLYLQNYSGRSRFDRLILIGTSCVPLCVEALQAAVSEAMAGRDVE
RYIKACQYLRSAAPDDVEGEVDQLWTQNMEIENKLETQRLEDELKGYKNNLIKETIRMGHEDLGKHYQSIGELDK
AMEAFTRMHKDVSTTKHIADCCLHISKVALQQRDWQVVLTNANKMSAGQGSSEESAIQAKSNILCGVALMCLGQY
VDAAQHFLQVSVQPSASEYSDLISPSDIATYGGLTALATMDRRQLQQRVLESLSFRSFLEHEVHIRKAINFFING
RYPSCLSTLESVRSDLLLDIYLQEHVQHLFSKIRSKCIQQYFIPYSNVTIQSLEAAFGRPDHDIESELATMIGQK
SLKARIDTKKKLLFAESKDARQQMQAEALETAQQYEKEAKERLRRINLIAAGLQVTSDGMDQAIESVGLVAGQSW
QQHDDDLYNHPINASAASVSF*
Coding >OphauG2|2802
ATGAGTGCCTCTCAGGCGGTGCACGGCTTCTTGCAGCAATTCCAGCCCCAACGGCTCATTCTTATCAATGAGCAG
CCCAAGTTCGACCTCGACCTCTACCTCCAAAACTATAGCGGTCGTTCTCGATTTGACCGCCTAATTCTCATCGGC
ACCAGCTGCGTACCGCTGTGTGTCGAGGCGCTCCAAGCTGCCGTCAGCGAGGCAATGGCTGGTCGCGACGTCGAG
AGGTACATCAAAGCATGCCAGTATCTTCGCTCTGCTGCGCCCGACGACGTTGAGGGCGAGGTGGACCAACTGTGG
ACACAGAATATGGAAATCGAGAACAAACTCGAGACGCAACGCCTCGAGGATGAGCTCAAGGGCTACAAGAATAAT
CTCATAAAAGAGACCATCAGGATGGGACATGAGGATCTTGGCAAACATTATCAGAGCATTGGAGAGCTAGACAAG
GCCATGGAAGCATTCACGCGCATGCACAAGGATGTCAGCACCACAAAGCACATCGCTGACTGCTGCTTGCACATT
TCAAAAGTTGCGCTGCAGCAACGGGACTGGCAAGTCGTTCTGACAAATGCTAATAAGATGAGTGCCGGACAAGGT
AGCTCTGAAGAGTCGGCAATCCAGGCCAAAAGCAATATTCTATGCGGCGTTGCCTTGATGTGTCTAGGCCAGTAC
GTCGACGCCGCTCAGCATTTTCTTCAAGTCAGTGTTCAACCTTCGGCCAGTGAATACTCGGATCTCATCAGCCCC
AGCGATATTGCTACTTATGGCGGCCTTACCGCCTTGGCCACAATGGATCGGCGCCAACTGCAGCAGCGAGTCTTG
GAAAGCTTGTCCTTTCGCTCATTTCTCGAGCATGAGGTGCACATTCGCAAAGCAATCAACTTCTTCATCAATGGC
CGATATCCCAGCTGTCTGTCGACCCTCGAGTCTGTGCGGTCCGATCTCTTGCTTGATATTTATCTGCAAGAGCAC
GTTCAACACCTCTTTTCCAAGATACGAAGCAAGTGCATTCAGCAGTACTTTATCCCCTACAGCAATGTCACTATA
CAAAGCCTTGAAGCTGCCTTTGGCAGACCCGACCACGATATTGAGTCGGAGCTGGCAACCATGATTGGTCAAAAG
TCACTCAAGGCGCGAATCGACACTAAGAAAAAGCTACTGTTTGCAGAATCTAAAGATGCGCGCCAACAAATGCAG
GCGGAAGCTCTTGAGACAGCTCAGCAGTACGAGAAGGAAGCCAAGGAAAGACTGCGACGCATCAATCTCATAGCT
GCTGGGCTCCAAGTCACGAGCGACGGCATGGACCAAGCCATCGAGTCGGTTGGCCTTGTGGCTGGACAGTCCTGG
CAGCAGCACGACGACGATCTATATAATCACCCAATCAATGCTAGCGCAGCCTCGGTCAGTTTCTAA
Transcript >OphauG2|2802
ATGAGTGCCTCTCAGGCGGTGCACGGCTTCTTGCAGCAATTCCAGCCCCAACGGCTCATTCTTATCAATGAGCAG
CCCAAGTTCGACCTCGACCTCTACCTCCAAAACTATAGCGGTCGTTCTCGATTTGACCGCCTAATTCTCATCGGC
ACCAGCTGCGTACCGCTGTGTGTCGAGGCGCTCCAAGCTGCCGTCAGCGAGGCAATGGCTGGTCGCGACGTCGAG
AGGTACATCAAAGCATGCCAGTATCTTCGCTCTGCTGCGCCCGACGACGTTGAGGGCGAGGTGGACCAACTGTGG
ACACAGAATATGGAAATCGAGAACAAACTCGAGACGCAACGCCTCGAGGATGAGCTCAAGGGCTACAAGAATAAT
CTCATAAAAGAGACCATCAGGATGGGACATGAGGATCTTGGCAAACATTATCAGAGCATTGGAGAGCTAGACAAG
GCCATGGAAGCATTCACGCGCATGCACAAGGATGTCAGCACCACAAAGCACATCGCTGACTGCTGCTTGCACATT
TCAAAAGTTGCGCTGCAGCAACGGGACTGGCAAGTCGTTCTGACAAATGCTAATAAGATGAGTGCCGGACAAGGT
AGCTCTGAAGAGTCGGCAATCCAGGCCAAAAGCAATATTCTATGCGGCGTTGCCTTGATGTGTCTAGGCCAGTAC
GTCGACGCCGCTCAGCATTTTCTTCAAGTCAGTGTTCAACCTTCGGCCAGTGAATACTCGGATCTCATCAGCCCC
AGCGATATTGCTACTTATGGCGGCCTTACCGCCTTGGCCACAATGGATCGGCGCCAACTGCAGCAGCGAGTCTTG
GAAAGCTTGTCCTTTCGCTCATTTCTCGAGCATGAGGTGCACATTCGCAAAGCAATCAACTTCTTCATCAATGGC
CGATATCCCAGCTGTCTGTCGACCCTCGAGTCTGTGCGGTCCGATCTCTTGCTTGATATTTATCTGCAAGAGCAC
GTTCAACACCTCTTTTCCAAGATACGAAGCAAGTGCATTCAGCAGTACTTTATCCCCTACAGCAATGTCACTATA
CAAAGCCTTGAAGCTGCCTTTGGCAGACCCGACCACGATATTGAGTCGGAGCTGGCAACCATGATTGGTCAAAAG
TCACTCAAGGCGCGAATCGACACTAAGAAAAAGCTACTGTTTGCAGAATCTAAAGATGCGCGCCAACAAATGCAG
GCGGAAGCTCTTGAGACAGCTCAGCAGTACGAGAAGGAAGCCAAGGAAAGACTGCGACGCATCAATCTCATAGCT
GCTGGGCTCCAAGTCACGAGCGACGGCATGGACCAAGCCATCGAGTCGGTTGGCCTTGTGGCTGGACAGTCCTGG
CAGCAGCACGACGACGATCTATATAATCACCCAATCAATGCTAGCGCAGCCTCGGTCAGTTTCTAA
Gene >OphauG2|2802
ATGAGTGCCTCTCAGGCGGTGCACGGCTTCTTGCAGCAATTCCAGCCCCAACGGCTCATTCTTATCAATGGTTCG
GCTGTATTCCAAGCTATTTGCCTTTGCAGCACCTACTGACGTTTGCCCTTTACCAGAGCAGCCCAAGTTCGACCT
CGACCTCTACCTCCAAAACTATAGCGGTGCGGTCCTCTCCTAGCCGTGAGGGCGTAATCTGCTGATCTCTCTTGC
CATGTCCAGGTCGTTCTCGATTTGACCGCCTAATTCTCATCGGCACCAGCTGCGTACCGCTGTGTGTCGAGGCGC
TCCAAGCTGCCGTCAGCGAGGCAATGGCTGGTCGCGACGTCGAGAGGTACATCAAAGCATGCCAGTATCTTCGCT
CTGCTGCGCCCGACGACGTTGAGGGCGAGGTGGACCAACTGTGGACACAGAATATGGAAATCGAGAACAAACTCG
AGACGCAACGCCTCGAGGATGAGCTCAAGGGCTACAAGAATAATCTCATAAAAGAGACCATCAGGGTAGGCTCCA
AGCGCCATGGTTGTTAGACAGCTAGGCCCGCACGCTCTACTTGCTGACGCTTCTCCAGATGGGACATGAGGATCT
TGGCAAACATTATCAGAGCATTGGAGAGCTAGACAAGGCCATGGAAGCATTCACGCGCATGCACAAGGATGTCAG
CACCACAAAGCACATCGCTGACTGCTGCTTGCACATTTCAAAAGTTGCGCTGCAGCAACGGGACTGGCAAGTCGT
TCTGACAAATGCTAATAAGATGAGTGCCGGACAAGGTAGCTCTGAAGAGTCGGCAATCCAGGCCAAAAGCAATAT
TCTATGCGGCGTTGCCTTGATGTGTCTAGGCCAGTACGTCGACGCCGCTCAGCATTTTCTTCAAGTCAGTGTTCA
ACCTTCGGCCAGTGAATACTCGGATCTCATCAGCCCCAGCGATATTGCTACTTATGGCGGCCTTACCGCCTTGGC
CACAATGGATCGGCGCCAACTGCAGCAGCGAGTCTTGGAAAGCTTGTCCTTTCGCTCATTTCTCGAGCATGAGGT
GCACATTCGCAAAGCAATCAACTTCTTCATCAATGGCCGATATCCCAGCTGTCTGTCGACCCTCGAGTCTGTGCG
GTCCGATCTCTTGCTTGATATTTATCTGCAAGAGCACGTTCAACACCTCTTTTCCAAGATACGAAGCAAGTGCAT
TCAGCAGTACTTTATCCCCTACAGCAATGTCACTATACAAAGCCTTGAAGCTGCCTTTGGCAGACCCGACCACGA
TATTGAGTCGGAGCTGGCAACCATGATTGGTCAAAAGTCACTCAAGGCGCGAATCGACACTAAGAAAAAGGTACG
CTCGGCTCTTCTCTTGCTGTCCATAATTCTGCTCATTTCGCCTTGTAAATCTAACTCGGCCCCATGAAGCTACTG
TTTGCAGAATCTAAAGATGCGCGCCAACAAATGCAGGCGGAAGCTCTTGAGACAGCTCAGCAGTACGAGAAGGAA
GCCAAGGAAAGACTGCGACGCATCAATCTCATAGCTGCTGGGCTCCAAGTCACGAGCGACGGCATGGACCAAGCC
ATCGAGTCGGTTGGCCTTGTGGCTGGACAGTCCTGGCAGCAGCACGACGACGATCTATATAATCACCCAATCAAT
GCTAGCGCAGCCTCGGTCAGTTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail