Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2796
Gene name
LocationContig_2063:1..839
Strand-
Gene length (bp)838
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.3E-19 44 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 7 234 8.0E-34
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 7 229 4.0E-29
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 80 220 5.0E-16
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 37 229 4.0E-14
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 81 229 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 7 234 8.0E-34
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 7 229 4.0E-29
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 80 220 5.0E-16
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 37 229 4.0E-14
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 81 229 4.0E-07
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 82 211 7.0E-07
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 38 229 9.0E-07
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 23 233 1.0E-06
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 43 225 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2796
MKPAISCCALLAARLGNITVFPGSTEYNSSVSSYYSSQAAAVRPACIVLAQNAEHVSIALGRLASAPYAPGHDNQ
TNCLFAIRSGGHAVAPSASNIEGGVTLDLRGLADVQIDETRTSVSVGVGNTWDAVYAKLQVANLSANGGRVAGVG
VGGLTLGAGISYFGTRYGWTADAVSNYQVVLANGTIVNASRHRNPDLYWALKGGGNNFGVVTRIDLDTFDQGAFW
GGLLTHPNNP*
Coding >OphauG2|2796
ATGAAGCCAGCTATATCCTGTTGCGCGCTCCTGGCCGCTCGTCTGGGCAATATCACGGTGTTTCCTGGCAGCACG
GAATACAACTCGTCGGTTTCTTCCTATTATTCCAGCCAAGCTGCCGCAGTTCGGCCTGCGTGTATAGTCTTGGCC
CAGAATGCAGAACACGTGTCCATTGCACTTGGCCGCCTGGCTTCAGCCCCCTACGCTCCCGGCCATGACAACCAG
ACAAACTGTCTCTTTGCAATCCGCTCCGGAGGCCACGCAGTCGCTCCCAGCGCTTCGAATATCGAGGGCGGTGTG
ACGCTGGACCTGCGCGGCCTGGCTGATGTCCAGATCGACGAGACAAGAACAAGTGTTTCCGTCGGCGTGGGAAAC
ACGTGGGATGCCGTCTACGCCAAGCTCCAAGTGGCCAATCTCAGCGCCAATGGCGGGCGCGTGGCGGGCGTGGGC
GTGGGCGGCCTGACGCTGGGAGCCGGCATTTCCTACTTTGGCACGCGCTACGGCTGGACGGCCGATGCCGTGTCC
AACTATCAAGTCGTGCTGGCAAACGGCACCATTGTCAATGCCAGCCGACACCGCAATCCAGATCTATACTGGGCT
CTCAAGGGCGGCGGCAACAACTTTGGCGTCGTGACGAGAATCGACCTCGACACCTTTGACCAGGGCGCCTTTTGG
GGCGGGCTGCTGACCCATCCCAACAATCCTTGA
Transcript >OphauG2|2796
ATGAAGCCAGCTATATCCTGTTGCGCGCTCCTGGCCGCTCGTCTGGGCAATATCACGGTGTTTCCTGGCAGCACG
GAATACAACTCGTCGGTTTCTTCCTATTATTCCAGCCAAGCTGCCGCAGTTCGGCCTGCGTGTATAGTCTTGGCC
CAGAATGCAGAACACGTGTCCATTGCACTTGGCCGCCTGGCTTCAGCCCCCTACGCTCCCGGCCATGACAACCAG
ACAAACTGTCTCTTTGCAATCCGCTCCGGAGGCCACGCAGTCGCTCCCAGCGCTTCGAATATCGAGGGCGGTGTG
ACGCTGGACCTGCGCGGCCTGGCTGATGTCCAGATCGACGAGACAAGAACAAGTGTTTCCGTCGGCGTGGGAAAC
ACGTGGGATGCCGTCTACGCCAAGCTCCAAGTGGCCAATCTCAGCGCCAATGGCGGGCGCGTGGCGGGCGTGGGC
GTGGGCGGCCTGACGCTGGGAGCCGGCATTTCCTACTTTGGCACGCGCTACGGCTGGACGGCCGATGCCGTGTCC
AACTATCAAGTCGTGCTGGCAAACGGCACCATTGTCAATGCCAGCCGACACCGCAATCCAGATCTATACTGGGCT
CTCAAGGGCGGCGGCAACAACTTTGGCGTCGTGACGAGAATCGACCTCGACACCTTTGACCAGGGCGCCTTTTGG
GGCGGGCTGCTGACCCATCCCAACAATCCTTGA
Gene >OphauG2|2796
ATGAAGCCAGCTATATCCTGTGTCTGTATCATGATTTCCTTTGACGCGACAAGGCCAGCTTGGCATCTAACCTCG
GCATCTTAGTGCGCGCTCCTGGCCGCTCGTCTGGGCAATATCACGGTGTTTCCTGGCAGCACGGAATACAACTCG
TCGGTTTCTTCCTATTATTCCAGCCAAGCTGCCGCAGTTCGGCCTGCGTGTATAGTCTTGGCCCAGAATGCAGAA
CACGTGTCCATTGCACTTGGCCGCCTGGCTTCAGCCCCCTACGCTCCCGGCCATGACAACCAGACAAACTGTCTC
TTTGCAATCCGCTCCGGAGGCCACGCAGTCGCTCCCAGCGCTTCGAATATCGAGGGCGGTGTGACGCTGGACCTG
CGCGGCCTGGCTGATGTCCAGATCGACGAGACAAGAACAAGTGTTTCCGTCGGCGTGGGAAACACGTGGGATGCC
GTCTACGCCAAGCTCCAAGTGGCCAATCTCAGCGCCAATGGCGGGCGCGTGGCGGGCGTGGGCGTGGGCGGCCTG
ACGCTGGGAGCCGGCATTTCCTACTTTGGCACGCGCTACGGCTGGACGGCCGATGCCGTGTCCAACTATCAAGTC
GTGCTGGCAAACGGCACCATTGTCAATGCCAGCCGACACCGCAATCCAGATCTATACTGGGCTCTCAAGGGCGGC
GGCAACAACTTTGGCGTCGTGACGAGAATCGACCTCGACACCTTTGACCAGGGCGCCTTTTGGGGCGGGCTGCTG
ACCCATCCCAACAATGTGTCGCGCGAGGCCATTCGCGAGTTTGTCAAGATGAATTCTCCAGACTCGTATGACCCT
TTTGCAGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail