Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2769
Gene name
LocationContig_205:3187..4136
Strand+
Gene length (bp)949
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11563 Protoglobin Protoglobin 2.2E-58 20 197

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0019825 oxygen binding Yes
GO:0020037 heme binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0046906 tetrapyrrole binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2769
MASSMPIKHIERRDLYTNLEARILYLHSFLDFSSRDIDALITGAKYIKALIPAIVNIVYKKLLQYDITANAFTTR
STSFQGPVDEAPDENSPQIIHRKMFLRAYLNKLCSDPSQMSFWEYLDKVGMMHVGLGRKHPLHVEYIHLGVCLGF
IQDIMTEAILSHPRMSLPRKTALVKALGKVIWIQNDLMAKWHVRDGAEYESPSLEDTHVEPEGYLHGQRILDDVV
PDACPFAGAVEKETLHGGHAESAEGPRRLTTDQVDMTA*
Coding >OphauG2|2769
ATGGCATCTTCAATGCCCATCAAACACATTGAGCGACGCGACCTCTACACAAACCTCGAAGCCCGTATCCTCTAC
CTTCACTCCTTTCTCGACTTTTCCAGCCGAGACATTGACGCCCTCATCACCGGCGCCAAATACATCAAAGCTCTC
ATCCCCGCCATTGTCAACATTGTCTACAAGAAACTGCTTCAATACGACATCACCGCCAATGCCTTTACAACTCGA
AGCACCTCGTTCCAAGGCCCTGTTGATGAGGCGCCAGACGAGAATAGCCCGCAGATTATCCATCGCAAGATGTTT
CTCCGCGCATACCTCAACAAGCTCTGCTCTGACCCAAGCCAAATGAGCTTTTGGGAGTACCTCGACAAGGTTGGC
ATGATGCACGTGGGCTTGGGCCGAAAACACCCTCTTCATGTCGAGTACATTCACCTGGGCGTCTGTCTCGGCTTC
ATCCAGGATATCATGACTGAAGCCATCTTGTCGCACCCGCGCATGTCGCTGCCACGCAAGACGGCCCTCGTCAAG
GCTCTAGGAAAGGTGATTTGGATCCAAAACGACCTCATGGCAAAGTGGCATGTGCGCGACGGCGCCGAGTACGAG
AGTCCCAGCTTGGAGGATACCCATGTGGAACCCGAGGGCTATCTCCACGGGCAGCGTATCCTCGACGATGTAGTC
CCAGATGCGTGTCCCTTTGCGGGCGCAGTGGAAAAGGAAACGCTCCATGGCGGCCATGCCGAGAGTGCTGAGGGG
CCGAGGAGGCTGACGACAGATCAAGTTGACATGACAGCATAG
Transcript >OphauG2|2769
ATGGCATCTTCAATGCCCATCAAACACATTGAGCGACGCGACCTCTACACAAACCTCGAAGCCCGTATCCTCTAC
CTTCACTCCTTTCTCGACTTTTCCAGCCGAGACATTGACGCCCTCATCACCGGCGCCAAATACATCAAAGCTCTC
ATCCCCGCCATTGTCAACATTGTCTACAAGAAACTGCTTCAATACGACATCACCGCCAATGCCTTTACAACTCGA
AGCACCTCGTTCCAAGGCCCTGTTGATGAGGCGCCAGACGAGAATAGCCCGCAGATTATCCATCGCAAGATGTTT
CTCCGCGCATACCTCAACAAGCTCTGCTCTGACCCAAGCCAAATGAGCTTTTGGGAGTACCTCGACAAGGTTGGC
ATGATGCACGTGGGCTTGGGCCGAAAACACCCTCTTCATGTCGAGTACATTCACCTGGGCGTCTGTCTCGGCTTC
ATCCAGGATATCATGACTGAAGCCATCTTGTCGCACCCGCGCATGTCGCTGCCACGCAAGACGGCCCTCGTCAAG
GCTCTAGGAAAGGTGATTTGGATCCAAAACGACCTCATGGCAAAGTGGCATGTGCGCGACGGCGCCGAGTACGAG
AGTCCCAGCTTGGAGGATACCCATGTGGAACCCGAGGGCTATCTCCACGGGCAGCGTATCCTCGACGATGTAGTC
CCAGATGCGTGTCCCTTTGCGGGCGCAGTGGAAAAGGAAACGCTCCATGGCGGCCATGCCGAGAGTGCTGAGGGG
CCGAGGAGGCTGACGACAGATCAAGTTGACATGACAGCATAG
Gene >OphauG2|2769
ATGGCATCTTCAATGCCCATCAAACACATTGAGCGACGCGACCTCTACACAAACCTCGAAGCCCGTATCCTCTAC
CTTCACTCCTTTCTCGACTTTTCCAGCCGTACGCACGACCCACCCTCTCTCATCCCAAGCCCAAACTCGAGCCAA
AAGAAAACTCATGTACAACAGGAGACATTGACGCCCTCATCACCGGCGCCAAATACATCAAAGCTCTCATCCCCG
CCATTGTCAACATTGTCTACAAGAAACTGCTTCAATACGACATCACCGCCAATGCCTTTACAACTCGAAGCACCT
CGTTCCAAGGCCCTGTTGATGAGGCGCCAGACGAGAATAGCCCGCAGATTATCCATCGCAAGATGTTTCTCCGCG
CATACCTCAACAAGCTCTGCTCTGACCCAAGCCAAATGAGCTTTTGGGAGTACCTCGACAAGGTTGGGTAAGTCG
AAAAGTCCTACGCCCCCTTTTTTTTCCCCGTGTAAAATCTGCTGCTAGTGCCCGTACGCTAAAGCCTTTCCTTTA
ATATAGCATGATGCACGTGGGCTTGGGCCGAAAACACCCTCTTCATGTCGAGTACATTCACCTGGGCGTCTGTCT
CGGCTTCATCCAGGATATCATGACTGAAGCCATCTTGTCGCACCCGCGCATGTCGCTGCCACGCAAGACGGCCCT
CGTCAAGGCTCTAGGAAAGGTGATTTGGATCCAAAACGACCTCATGGCAAAGTGGCATGTGCGCGACGGCGCCGA
GTACGAGAGTCCCAGCTTGGAGGATACCCATGTGGAACCCGAGGGCTATCTCCACGGGCAGCGTATCCTCGACGA
TGTAGTCCCAGATGCGTGTCCCTTTGCGGGCGCAGTGGAAAAGGAAACGCTCCATGGCGGCCATGCCGAGAGTGC
TGAGGGGCCGAGGAGGCTGACGACAGATCAAGTTGACATGACAGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail