Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2755
Gene name
LocationContig_204:6653..8309
Strand-
Gene length (bp)1656
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02636 Methyltransf_28 Putative S-adenosyl-L-methionine-dependent methyltransferase 1.2E-39 186 460

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14138|NDUF7_SCHPO NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25A8.03c PE=3 SV=2 97 476 1.0E-23

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1976
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2755 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4426
Ophiocordyceps camponoti-floridani Ophcf2|03371
Ophiocordyceps camponoti-rufipedis Ophun1|582
Ophiocordyceps kimflemingae Ophio5|801
Ophiocordyceps subramaniannii Hirsu2|2170

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2755
MDSPIVAQLFRQLFHHRASGCRARCANMASSPPPPPTAASTTRRSYAARASSDRGLKSNESRWQQRTNVLPQDRR
TEFAQYPTMSAKELRSRTERPRRVKMLLRDFIDDSLYNPSYGYFSKQAVIFSPGQPFNFGSMRDQLAFQAELGRR
YTAFEDALDAKHGLDPTRQLWHTPTELFSPHYGEAIARYLVANYRLTTYPYHDLVIYEMGAGRGTLMLNILNYIR
AADPQVYARTRFNIIEISSSLAALQSRHLAATARSRGHAHRVDIINCSIFDWHRHVPEPCFFLAMEVFDNFAHDS
IRYDMLSEEPLQAHVLIDAHGEFFEFYLGALDPIAARFFRVRHAATCGLYPRPYPANPLLRRLAAKLPFAPNLSA
PEFIPTRLMQFFDVLEKYFPAHRLLTSDFDSLPQAVKGLNAPVVQTRYQRRTVPVTTPLVHQGYFDILFPTDFCV
TEAMYRAITGKLTRVMSHGDFMRRWAYVEDTETRSGENPLLSHYKNASVMVTL*
Coding >OphauG2|2755
ATGGACTCGCCCATTGTGGCCCAGCTGTTTCGCCAGCTCTTCCACCACCGCGCCTCTGGCTGCCGAGCCCGATGC
GCCAACATGGCATCATCTCCTCCTCCTCCTCCTACTGCTGCCTCCACCACCCGCCGCAGCTACGCCGCCAGAGCA
TCCTCTGATCGCGGCCTCAAGTCCAACGAAAGCCGCTGGCAGCAACGCACCAACGTGCTGCCCCAAGACCGCCGC
ACCGAGTTTGCCCAGTATCCCACCATGTCGGCCAAGGAGCTGCGCTCTCGTACCGAGCGTCCGCGCAGAGTCAAG
ATGCTGCTCCGCGACTTTATCGACGACAGCCTCTACAACCCCTCGTATGGCTACTTTTCCAAACAGGCCGTCATC
TTCTCCCCCGGACAACCATTCAACTTTGGCTCCATGCGCGACCAGCTCGCCTTTCAAGCCGAGCTCGGCCGCCGC
TACACCGCCTTTGAAGATGCCCTCGACGCAAAACACGGCCTCGACCCAACCCGCCAGCTCTGGCACACCCCCACC
GAGCTCTTTAGCCCCCACTACGGCGAGGCCATTGCTCGCTACCTCGTGGCAAACTACCGCCTCACCACCTATCCC
TACCACGACCTCGTCATCTACGAAATGGGCGCTGGCCGCGGCACCCTCATGCTCAACATCCTCAACTACATTCGC
GCCGCCGACCCCCAAGTCTACGCCCGCACTCGCTTCAACATTATCGAGATTTCCTCCTCCCTCGCTGCTCTGCAG
TCGCGCCACCTCGCTGCCACGGCTCGCTCCCGCGGCCACGCCCATCGCGTCGACATTATCAACTGCTCCATCTTT
GACTGGCATCGCCACGTCCCCGAACCTTGCTTCTTCCTCGCCATGGAGGTCTTTGACAACTTTGCCCACGACAGC
ATTCGCTACGACATGCTCTCGGAAGAACCTCTGCAAGCCCATGTTCTCATTGACGCCCACGGCGAGTTCTTTGAG
TTTTACCTCGGCGCCCTCGACCCCATTGCCGCTCGCTTCTTTCGCGTTCGCCATGCCGCAACCTGCGGCCTCTAT
CCTCGCCCTTATCCTGCCAATCCTCTGCTGCGCCGCCTCGCCGCCAAGCTTCCTTTTGCTCCCAACCTCTCAGCC
CCCGAATTCATACCCACCCGCCTCATGCAGTTTTTCGACGTGCTGGAAAAGTACTTTCCCGCTCACCGCCTCCTC
ACCTCCGACTTTGACTCCCTGCCCCAGGCTGTCAAGGGCCTCAATGCTCCCGTTGTCCAGACGCGCTACCAGCGC
CGAACCGTCCCTGTCACGACGCCCTTGGTCCACCAAGGATACTTTGACATTCTCTTCCCCACAGACTTTTGCGTA
ACAGAAGCCATGTATCGCGCCATTACCGGCAAACTCACCCGCGTCATGTCCCACGGAGACTTTATGCGCCGCTGG
GCCTATGTCGAAGATACGGAAACGCGCAGCGGCGAGAACCCGCTCTTGTCCCATTACAAAAACGCCAGCGTCATG
GTTACTCTCTAG
Transcript >OphauG2|2755
ATGGACTCGCCCATTGTGGCCCAGCTGTTTCGCCAGCTCTTCCACCACCGCGCCTCTGGCTGCCGAGCCCGATGC
GCCAACATGGCATCATCTCCTCCTCCTCCTCCTACTGCTGCCTCCACCACCCGCCGCAGCTACGCCGCCAGAGCA
TCCTCTGATCGCGGCCTCAAGTCCAACGAAAGCCGCTGGCAGCAACGCACCAACGTGCTGCCCCAAGACCGCCGC
ACCGAGTTTGCCCAGTATCCCACCATGTCGGCCAAGGAGCTGCGCTCTCGTACCGAGCGTCCGCGCAGAGTCAAG
ATGCTGCTCCGCGACTTTATCGACGACAGCCTCTACAACCCCTCGTATGGCTACTTTTCCAAACAGGCCGTCATC
TTCTCCCCCGGACAACCATTCAACTTTGGCTCCATGCGCGACCAGCTCGCCTTTCAAGCCGAGCTCGGCCGCCGC
TACACCGCCTTTGAAGATGCCCTCGACGCAAAACACGGCCTCGACCCAACCCGCCAGCTCTGGCACACCCCCACC
GAGCTCTTTAGCCCCCACTACGGCGAGGCCATTGCTCGCTACCTCGTGGCAAACTACCGCCTCACCACCTATCCC
TACCACGACCTCGTCATCTACGAAATGGGCGCTGGCCGCGGCACCCTCATGCTCAACATCCTCAACTACATTCGC
GCCGCCGACCCCCAAGTCTACGCCCGCACTCGCTTCAACATTATCGAGATTTCCTCCTCCCTCGCTGCTCTGCAG
TCGCGCCACCTCGCTGCCACGGCTCGCTCCCGCGGCCACGCCCATCGCGTCGACATTATCAACTGCTCCATCTTT
GACTGGCATCGCCACGTCCCCGAACCTTGCTTCTTCCTCGCCATGGAGGTCTTTGACAACTTTGCCCACGACAGC
ATTCGCTACGACATGCTCTCGGAAGAACCTCTGCAAGCCCATGTTCTCATTGACGCCCACGGCGAGTTCTTTGAG
TTTTACCTCGGCGCCCTCGACCCCATTGCCGCTCGCTTCTTTCGCGTTCGCCATGCCGCAACCTGCGGCCTCTAT
CCTCGCCCTTATCCTGCCAATCCTCTGCTGCGCCGCCTCGCCGCCAAGCTTCCTTTTGCTCCCAACCTCTCAGCC
CCCGAATTCATACCCACCCGCCTCATGCAGTTTTTCGACGTGCTGGAAAAGTACTTTCCCGCTCACCGCCTCCTC
ACCTCCGACTTTGACTCCCTGCCCCAGGCTGTCAAGGGCCTCAATGCTCCCGTTGTCCAGACGCGCTACCAGCGC
CGAACCGTCCCTGTCACGACGCCCTTGGTCCACCAAGGATACTTTGACATTCTCTTCCCCACAGACTTTTGCGTA
ACAGAAGCCATGTATCGCGCCATTACCGGCAAACTCACCCGCGTCATGTCCCACGGAGACTTTATGCGCCGCTGG
GCCTATGTCGAAGATACGGAAACGCGCAGCGGCGAGAACCCGCTCTTGTCCCATTACAAAAACGCCAGCGTCATG
GTTACTCTCTAG
Gene >OphauG2|2755
ATGGACTCGCCCATTGTGGCCCAGCTGTTTCGCCAGCTCTTCCACCACCGCGCCTCTGGCTGCCGAGCCCGATGC
GCCAACATGGCATCATCTCCTCCTCCTCCTCCTACTGCTGCCTCCACCACCCGCCGCAGCTACGCCGCCAGAGCA
TCCTCTGATCGCGGCCTCAAGTCCAACGAAAGCCGCTGGCAGCAACGCACCAACGTGCTGCCCCAAGACCGCCGC
ACCGAGTTTGCCCAGTATCCCACCATGTCGGCCAAGGAGCTGCGCTCTCGTACCGAGCGTCCGCGCAGAGTCAAG
ATGCTGCTCCGCGACTTTATCGACGGTACACCTTGCTCTCCTTTTCTTTTTTTAAAATGCTCTCTGCATACCCCC
CCCCTGGTAGCAAGTTTCCATGCTAACCCAAAGGTCTTCCAGACAGCCTCTACAACCCCTCGTATGGCTACTTTT
CCAAACAGGCCGTCATCTTCTCCCCCGGACAACCATTCAACTTTGGCTCCATGCGCGACCAGCTCGCCTTTCAAG
CCGAGCTCGGCCGCCGCTACACCGCCTTTGAAGATGCCCTCGACGCAAAACACGGCCTCGACCCAACCCGCCAGC
TCTGGCACACCCCCACCGAGCTCTTTAGCCCCCACTACGGCGAGGCCATTGCTCGCTACCTCGTGGCAAACTACC
GCCTCACCACCTATCCCTACCACGACCTCGTCATCTACGAAATGGGCGCTGGCCGCGGCACCCTCATGCTCAACA
TCCTCAACTACATTCGCGCCGCCGACCCCCAAGTCTACGCCCGCACTCGCTTCAACATTATCGAGATTTCCTCCT
CCCTCGCTGCTCTGCAGTCGCGCCACCTCGCTGCCACGGCTCGCTCCCGCGGCCACGCCCATCGCGTCGACATTA
TCAACTGCTCCATCTTTGACTGGCATCGCCACGTCCCCGAACCTTGCTTCTTCCTCGCCATGGAGGTCTTTGACA
ACTTTGCCCACGACAGCATTCGCTACGACATGCTCTCGGAAGAACCTCTGCAAGCCCATGTTCTCATTGACGCCC
ACGGCGAGTTCTTTGAGTTTTACCTCGGCGCCCTCGACCCCATTGCCGCTCGCTTCTTTCGCGTTCGCCATGCCG
CAACCTGCGGCCTCTATCCTCGCCCTTATCCTGCCAATCCTCTGCTGCGCCGCCTCGCCGCCAAGCTTCCTTTTG
CTCCCAACCTCTCAGCCCCCGAATTCATACCCACCCGCCTCATGCAGTTTTTCGACGTGCTGGAAAAGTACTTTC
CCGCTCACCGCCTCCTCACCTCCGACTTTGACTCCCTGCCCCAGGCTGTCAAGGGCCTCAATGCTCCCGTTGTCC
AGACGCGCTACCAGCGCCGAACCGTCCCTGTCACGACGCCCTTGGTATGCCCCAAGTCCGGGCTGTCTGGCTCTA
ATCTGACCACTCTCTCTACAGGTCCACCAAGGATACTTTGACATTCTCTTCCCCACAGACTTTTGCGTAACAGAA
GCCATGTATCGCGCCATTACCGGCAAACTCACCCGCGTCATGTCCCACGGAGACTTTATGCGCCGCTGGGCCTAT
GTCGAAGATACGGAAACGCGCAGCGGCGAGAACCCGCTCTTGTCCCATTACAAAAACGCCAGCGTCATGGTTACT
CTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail