Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2753
Gene name
LocationContig_204:1580..2329
Strand-
Gene length (bp)749
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20354 DUF6649 Family of unknown function (DUF6649) 2.5E-33 27 194

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5885
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2753 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4428
Ophiocordyceps camponoti-floridani Ophcf2|03369
Ophiocordyceps camponoti-rufipedis Ophun1|584
Ophiocordyceps kimflemingae Ophio5|2260

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2753
MVQRVVNAAWAHGTGTAPDATSMDMDVDAAAGRKRKAESQDNERLSKRLSLLNLERNGSKLYVHVETPSSSCAPS
NAAPPPQQADNQDVMQLDDTGHKVYIYNLDDELSSSDGDSDDGKLAFLPDIEKHLRSQRIPPHILANPQGELAGM
QIVLYSDPRSLSVPEEHDGVRKAIIEARRRARDRYCQPGASSAQQPQPSISEAPPAPPVHLDDNDYDAMDID*
Coding >OphauG2|2753
ATGGTGCAGCGCGTCGTCAATGCCGCCTGGGCCCATGGCACCGGCACAGCCCCAGACGCGACCTCAATGGACATG
GACGTGGACGCTGCCGCTGGCCGGAAGCGCAAGGCCGAGTCGCAGGACAACGAACGCCTGTCAAAGCGGCTTAGC
CTGCTTAATCTCGAACGCAATGGCTCTAAACTCTACGTGCACGTCGAGACGCCATCTTCGTCCTGCGCCCCTAGC
AATGCTGCGCCTCCCCCGCAACAAGCAGACAACCAAGACGTGATGCAGCTCGACGACACAGGGCACAAGGTCTAC
ATTTACAATCTCGATGACGAACTCTCTTCGTCCGACGGCGACAGCGACGACGGCAAGCTTGCCTTCCTGCCCGAC
ATTGAGAAGCACCTCCGCAGCCAGCGCATACCGCCTCACATCCTGGCCAACCCCCAAGGCGAACTCGCCGGCATG
CAAATTGTTCTCTATTCAGACCCGCGCTCCCTCTCGGTCCCGGAGGAACACGACGGCGTGCGCAAGGCCATTATT
GAAGCACGCCGACGTGCTAGAGATCGGTATTGCCAGCCTGGCGCCTCGTCTGCCCAACAACCGCAGCCCTCCATC
TCCGAGGCACCCCCAGCTCCCCCTGTACACCTTGATGATAATGACTACGACGCCATGGATATAGATTGA
Transcript >OphauG2|2753
ATGGTGCAGCGCGTCGTCAATGCCGCCTGGGCCCATGGCACCGGCACAGCCCCAGACGCGACCTCAATGGACATG
GACGTGGACGCTGCCGCTGGCCGGAAGCGCAAGGCCGAGTCGCAGGACAACGAACGCCTGTCAAAGCGGCTTAGC
CTGCTTAATCTCGAACGCAATGGCTCTAAACTCTACGTGCACGTCGAGACGCCATCTTCGTCCTGCGCCCCTAGC
AATGCTGCGCCTCCCCCGCAACAAGCAGACAACCAAGACGTGATGCAGCTCGACGACACAGGGCACAAGGTCTAC
ATTTACAATCTCGATGACGAACTCTCTTCGTCCGACGGCGACAGCGACGACGGCAAGCTTGCCTTCCTGCCCGAC
ATTGAGAAGCACCTCCGCAGCCAGCGCATACCGCCTCACATCCTGGCCAACCCCCAAGGCGAACTCGCCGGCATG
CAAATTGTTCTCTATTCAGACCCGCGCTCCCTCTCGGTCCCGGAGGAACACGACGGCGTGCGCAAGGCCATTATT
GAAGCACGCCGACGTGCTAGAGATCGGTATTGCCAGCCTGGCGCCTCGTCTGCCCAACAACCGCAGCCCTCCATC
TCCGAGGCACCCCCAGCTCCCCCTGTACACCTTGATGATAATGACTACGACGCCATGGATATAGATTGA
Gene >OphauG2|2753
ATGGTGCAGCGCGTCGTCAATGCCGCCTGGGCCCATGGCACCGGCACAGCCCCAGACGCGACCTCAATGGACATG
GACGTGGACGCTGCCGCTGGCCGGAAGCGCAAGGCCGAGTCGCAGGACAACGAACGCCTGTCAAAGCGGCTTAGC
CTGCTTAATCTCGGTAAGACACTTGCTTTTTCCTCCCCCTCCCTCTGCTTCGGCCGACATGACTGGCTGCTGACA
GCGCGTTTGCTTTTGCAGAACGCAATGGCTCTAAACTCTACGTGCACGTCGAGACGCCATCTTCGTCCTGCGCCC
CTAGCAATGCTGCGCCTCCCCCGCAACAAGCAGACAACCAAGACGTGATGCAGCTCGACGACACAGGGCACAAGG
TCTACATTTACAATCTCGATGACGAACTCTCTTCGTCCGACGGCGACAGCGACGACGGCAAGCTTGCCTTCCTGC
CCGACATTGAGAAGCACCTCCGCAGCCAGCGCATACCGCCTCACATCCTGGCCAACCCCCAAGGCGAACTCGCCG
GCATGCAAATTGTTCTCTATTCAGACCCGCGCTCCCTCTCGGTCCCGGAGGAACACGACGGCGTGCGCAAGGCCA
TTATTGAAGCACGCCGACGTGCTAGAGATCGGTATTGCCAGCCTGGCGCCTCGTCTGCCCAACAACCGCAGCCCT
CCATCTCCGAGGCACCCCCAGCTCCCCCTGTACACCTTGATGATAATGACTACGACGCCATGGATATAGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail