Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2738
Gene name
LocationContig_203:533..3229
Strand-
Gene length (bp)2696
Transcript length (bp)2466
Coding sequence length (bp)2466
Protein length (aa) 822

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08553 VID27 VID27 C-terminal WD40-like domain 8.2E-189 436 786
PF17748 VID27_N VID27 N-terminal region 6.5E-75 1 176
PF17747 VID27_PH VID27 PH-like domain 4.9E-38 255 361

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR3|VID27_SCHPO Vacuolar import and degradation protein 27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vid27 PE=1 SV=1 1 821 0.0E+00
sp|P40157|VID27_YEAST Vacuolar import and degradation protein 27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VID27 PE=1 SV=1 6 785 1.0E-145
sp|Q555V7|VID27_DICDI VID27-like protein OS=Dictyostelium discoideum GN=DDB_G0274813 PE=3 SV=1 421 774 1.0E-61
sp|P40781|CYPR4_CYNCA Protein CYPRO4 OS=Cynara cardunculus GN=CYPRO4 PE=2 SV=1 485 749 3.0E-26

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2115
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2738 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6591
Ophiocordyceps camponoti-floridani Ophcf2|05193
Ophiocordyceps camponoti-rufipedis Ophun1|3291
Ophiocordyceps kimflemingae Ophio5|6048
Ophiocordyceps subramaniannii Hirsu2|2517

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2738
MFVLRNVGKLLFGSAAQESIIDIPQGQLYLVRPLSPKGYSELIFRDATIRIRRTNQDFHYQLVVQRVFEEGEAEL
LADEEGDDLEVDALAAERDEKTFLLDEALCFRVDARHDGEKVFAWKDLSGDTGDVYEFVCDTQVSASQLQQFIET
ARHCQYERKYRKPHTTASEADLKQFDFEDIDYPIPPASPLNSPSLTRSIDFDSVDHIEDMPTPNKAARSAAQRDM
AVVPSQEPDSEPIEEQAQLTAPEPPPTPLEIYATVTAELHIFEPQPGHFAMVDDSVIATISEVGKWEYWLQVDGK
GKHWLGTPLVADINPIFDFEYLSFVFNYFSKDGTARSWLLRFKDQPTLEKAQQAVLQAIWERLNETKWAKIQEKE
REYVLDSFADLAMEDAPEHQEEEEEEDESPVDDEDDQGVHSEAYDSEDDEHAEQERNQGDVNSQLAVGYKHDRSF
VVRGSKIGVFSHTDDNRLKFATNISKVTTPNGKLMSPKKVMLHSEDRDLIMQNRVDPNKLYRMDIEYGKVVDEWN
VHDDVPVVNFAPENKFAQMTAEQTFLGISNNALYRIDPRLSGNKLVDTDMKQYASKNDFSALATTEKGYIAVASN
KGDIRLFDRLGIRAKTQLPALGDPIIGMDVSADGRWILGTTKNYLLLIDAQQKGGKNEGKLGFERAFSADSKPHP
RRLGLTPEHVAQFHYETGKPVSFTPAKFNTGAGAEETSIITATGPYIIEWNLKRLLRSPKGAYKIKRYQEDVQAD
DFKFGSDKNVIVALPNEVNMVAKQSLRRPTRESLVGNGLGVGAVRRSSARIGTRESGRYKLGKDDIVNAPY*
Coding >OphauG2|2738
ATGTTTGTTCTACGCAACGTCGGCAAGCTGCTCTTCGGCTCTGCAGCTCAGGAATCCATCATCGATATCCCTCAA
GGACAGCTTTACTTGGTTCGCCCGCTGTCGCCCAAGGGTTACTCAGAACTCATCTTTAGAGACGCCACCATCCGC
ATACGTCGCACAAATCAAGACTTTCATTATCAGCTTGTCGTACAACGCGTCTTTGAAGAAGGCGAGGCTGAGCTC
CTTGCCGACGAAGAAGGCGACGACTTGGAAGTCGACGCTCTCGCTGCCGAGCGGGACGAAAAGACGTTTCTACTC
GACGAGGCGCTGTGCTTTCGCGTTGACGCCAGACACGACGGCGAAAAGGTTTTTGCTTGGAAGGATCTCAGTGGC
GACACGGGTGACGTTTACGAATTCGTTTGCGATACTCAAGTCTCGGCTTCCCAGCTGCAACAATTCATCGAGACT
GCTCGCCACTGTCAATACGAGCGCAAATACCGCAAGCCGCACACCACGGCCTCGGAAGCCGATCTCAAACAATTT
GACTTTGAAGACATTGATTATCCCATCCCCCCCGCGAGCCCCCTCAACAGCCCCTCACTTACCCGGTCCATTGAC
TTTGACTCTGTCGATCACATTGAAGACATGCCCACGCCAAACAAGGCGGCCAGATCGGCGGCTCAGCGGGACATG
GCGGTTGTCCCATCCCAGGAGCCTGACAGTGAGCCAATTGAGGAGCAAGCTCAGCTCACGGCTCCTGAACCTCCG
CCGACACCCCTTGAAATCTACGCCACGGTGACTGCTGAACTGCACATATTCGAGCCACAGCCAGGACACTTTGCC
ATGGTGGACGACTCAGTCATTGCCACAATCTCGGAAGTGGGGAAATGGGAATACTGGCTGCAAGTTGACGGCAAG
GGTAAACATTGGCTAGGAACGCCGCTTGTTGCTGATATCAACCCTATTTTCGATTTTGAATATCTCTCATTTGTA
TTCAACTACTTCAGCAAGGACGGTACAGCCAGATCCTGGCTCTTGCGCTTTAAGGACCAGCCAACCTTGGAGAAG
GCTCAGCAGGCAGTGTTGCAGGCCATTTGGGAGAGACTCAACGAGACCAAGTGGGCAAAGATTCAAGAAAAGGAG
CGCGAGTACGTGCTCGATAGCTTTGCCGATTTGGCCATGGAAGACGCCCCTGAGCATCAAGAAGAGGAAGAGGAG
GAGGATGAATCGCCAGTCGACGACGAGGACGACCAGGGCGTGCACAGTGAAGCCTATGATTCGGAGGATGATGAG
CACGCTGAGCAAGAGAGAAACCAAGGCGACGTCAACTCGCAATTGGCTGTTGGCTACAAGCACGATCGGTCCTTT
GTTGTGCGCGGCTCCAAGATTGGCGTCTTTTCACATACCGACGACAATCGCCTCAAGTTTGCCACGAATATCTCA
AAGGTGACGACTCCAAACGGAAAGCTCATGAGTCCCAAGAAGGTGATGCTGCATAGCGAGGACCGGGATCTCATC
ATGCAAAACCGGGTGGATCCCAATAAGCTTTACCGTATGGATATTGAGTACGGCAAGGTGGTTGACGAGTGGAAC
GTTCACGACGACGTGCCCGTTGTCAACTTTGCCCCCGAGAACAAGTTTGCGCAAATGACTGCTGAGCAAACGTTT
CTTGGTATTTCCAATAATGCGCTCTATCGCATCGACCCGCGTCTGTCTGGAAACAAGCTCGTCGACACAGACATG
AAGCAGTATGCATCGAAAAACGACTTTTCAGCTCTTGCCACGACGGAAAAGGGCTACATTGCCGTGGCGAGCAAC
AAGGGCGACATTCGCCTATTTGACCGCCTGGGCATCCGGGCAAAGACGCAACTTCCCGCCCTGGGCGATCCCATT
ATCGGCATGGACGTGTCGGCGGATGGCCGGTGGATTCTGGGAACAACAAAGAACTACTTGCTGCTCATTGACGCA
CAGCAAAAGGGCGGCAAGAATGAGGGTAAGCTGGGATTCGAAAGGGCCTTTTCCGCCGACTCGAAGCCCCATCCG
CGCCGCCTCGGCCTGACGCCCGAACACGTTGCGCAGTTTCATTACGAAACCGGCAAGCCGGTATCCTTTACGCCC
GCAAAGTTCAACACGGGTGCCGGCGCCGAGGAAACGAGCATCATTACCGCCACGGGGCCCTACATCATTGAATGG
AACCTGAAGCGCCTGCTGCGCAGCCCCAAGGGCGCGTACAAGATTAAGCGCTACCAGGAAGACGTGCAGGCCGAC
GACTTTAAATTCGGGTCTGACAAAAACGTCATTGTTGCCCTGCCAAACGAGGTCAACATGGTGGCCAAGCAGAGT
CTGCGCCGCCCCACGCGTGAGAGCCTCGTTGGAAATGGCCTGGGTGTCGGCGCGGTGCGGCGAAGCTCGGCGCGT
ATTGGGACGAGGGAGAGCGGGCGATATAAGCTTGGCAAGGATGATATTGTGAATGCGCCTTATTAA
Transcript >OphauG2|2738
ATGTTTGTTCTACGCAACGTCGGCAAGCTGCTCTTCGGCTCTGCAGCTCAGGAATCCATCATCGATATCCCTCAA
GGACAGCTTTACTTGGTTCGCCCGCTGTCGCCCAAGGGTTACTCAGAACTCATCTTTAGAGACGCCACCATCCGC
ATACGTCGCACAAATCAAGACTTTCATTATCAGCTTGTCGTACAACGCGTCTTTGAAGAAGGCGAGGCTGAGCTC
CTTGCCGACGAAGAAGGCGACGACTTGGAAGTCGACGCTCTCGCTGCCGAGCGGGACGAAAAGACGTTTCTACTC
GACGAGGCGCTGTGCTTTCGCGTTGACGCCAGACACGACGGCGAAAAGGTTTTTGCTTGGAAGGATCTCAGTGGC
GACACGGGTGACGTTTACGAATTCGTTTGCGATACTCAAGTCTCGGCTTCCCAGCTGCAACAATTCATCGAGACT
GCTCGCCACTGTCAATACGAGCGCAAATACCGCAAGCCGCACACCACGGCCTCGGAAGCCGATCTCAAACAATTT
GACTTTGAAGACATTGATTATCCCATCCCCCCCGCGAGCCCCCTCAACAGCCCCTCACTTACCCGGTCCATTGAC
TTTGACTCTGTCGATCACATTGAAGACATGCCCACGCCAAACAAGGCGGCCAGATCGGCGGCTCAGCGGGACATG
GCGGTTGTCCCATCCCAGGAGCCTGACAGTGAGCCAATTGAGGAGCAAGCTCAGCTCACGGCTCCTGAACCTCCG
CCGACACCCCTTGAAATCTACGCCACGGTGACTGCTGAACTGCACATATTCGAGCCACAGCCAGGACACTTTGCC
ATGGTGGACGACTCAGTCATTGCCACAATCTCGGAAGTGGGGAAATGGGAATACTGGCTGCAAGTTGACGGCAAG
GGTAAACATTGGCTAGGAACGCCGCTTGTTGCTGATATCAACCCTATTTTCGATTTTGAATATCTCTCATTTGTA
TTCAACTACTTCAGCAAGGACGGTACAGCCAGATCCTGGCTCTTGCGCTTTAAGGACCAGCCAACCTTGGAGAAG
GCTCAGCAGGCAGTGTTGCAGGCCATTTGGGAGAGACTCAACGAGACCAAGTGGGCAAAGATTCAAGAAAAGGAG
CGCGAGTACGTGCTCGATAGCTTTGCCGATTTGGCCATGGAAGACGCCCCTGAGCATCAAGAAGAGGAAGAGGAG
GAGGATGAATCGCCAGTCGACGACGAGGACGACCAGGGCGTGCACAGTGAAGCCTATGATTCGGAGGATGATGAG
CACGCTGAGCAAGAGAGAAACCAAGGCGACGTCAACTCGCAATTGGCTGTTGGCTACAAGCACGATCGGTCCTTT
GTTGTGCGCGGCTCCAAGATTGGCGTCTTTTCACATACCGACGACAATCGCCTCAAGTTTGCCACGAATATCTCA
AAGGTGACGACTCCAAACGGAAAGCTCATGAGTCCCAAGAAGGTGATGCTGCATAGCGAGGACCGGGATCTCATC
ATGCAAAACCGGGTGGATCCCAATAAGCTTTACCGTATGGATATTGAGTACGGCAAGGTGGTTGACGAGTGGAAC
GTTCACGACGACGTGCCCGTTGTCAACTTTGCCCCCGAGAACAAGTTTGCGCAAATGACTGCTGAGCAAACGTTT
CTTGGTATTTCCAATAATGCGCTCTATCGCATCGACCCGCGTCTGTCTGGAAACAAGCTCGTCGACACAGACATG
AAGCAGTATGCATCGAAAAACGACTTTTCAGCTCTTGCCACGACGGAAAAGGGCTACATTGCCGTGGCGAGCAAC
AAGGGCGACATTCGCCTATTTGACCGCCTGGGCATCCGGGCAAAGACGCAACTTCCCGCCCTGGGCGATCCCATT
ATCGGCATGGACGTGTCGGCGGATGGCCGGTGGATTCTGGGAACAACAAAGAACTACTTGCTGCTCATTGACGCA
CAGCAAAAGGGCGGCAAGAATGAGGGTAAGCTGGGATTCGAAAGGGCCTTTTCCGCCGACTCGAAGCCCCATCCG
CGCCGCCTCGGCCTGACGCCCGAACACGTTGCGCAGTTTCATTACGAAACCGGCAAGCCGGTATCCTTTACGCCC
GCAAAGTTCAACACGGGTGCCGGCGCCGAGGAAACGAGCATCATTACCGCCACGGGGCCCTACATCATTGAATGG
AACCTGAAGCGCCTGCTGCGCAGCCCCAAGGGCGCGTACAAGATTAAGCGCTACCAGGAAGACGTGCAGGCCGAC
GACTTTAAATTCGGGTCTGACAAAAACGTCATTGTTGCCCTGCCAAACGAGGTCAACATGGTGGCCAAGCAGAGT
CTGCGCCGCCCCACGCGTGAGAGCCTCGTTGGAAATGGCCTGGGTGTCGGCGCGGTGCGGCGAAGCTCGGCGCGT
ATTGGGACGAGGGAGAGCGGGCGATATAAGCTTGGCAAGGATGATATTGTGAATGCGCCTTATTAA
Gene >OphauG2|2738
ATGTTTGTTCTACGCAACGGTGAGTCTAGCTGGCCTTTCTTTTTTGCAGCAGCCAATGACATTGGGGCCCGGCGC
CCCGCCATTTCCTTGCTCGTTCAAGGCAAGCAATCACTTCTTCAACTTGTATTATTAGCTGCTACTAGCCGCCTT
GTACTTGCATCTTGACTCGTTTTTTCTTCCCTTTACTTTTTGTACTCTCATCTCTTCTCCATCAAACACGCCCGG
CTGATGACTGCCTCTTCTCCATAGTCGGCAAGCTGCTCTTCGGCTCTGCAGCTCAGGAATCCATCATCGATATCC
CTCAAGGACAGCTTTACTTGGTTCGCCCGCTGTCGCCCAAGGGTTACTCAGAACTCATCTTTAGAGACGCCACCA
TCCGCATACGTCGCACAAATCAAGACTTTCATTATCAGCTTGTCGTACAACGCGTCTTTGAAGAAGGCGAGGCTG
AGCTCCTTGCCGACGAAGAAGGCGACGACTTGGAAGTCGACGCTCTCGCTGCCGAGCGGGACGAAAAGACGTTTC
TACTCGACGAGGCGCTGTGCTTTCGCGTTGACGCCAGACACGACGGCGAAAAGGTTTTTGCTTGGAAGGATCTCA
GTGGCGACACGGGTGACGTTTACGAATTCGTTTGCGATACTCAAGTCTCGGCTTCCCAGCTGCAACAATTCATCG
AGACTGCTCGCCACTGTCAATACGAGCGCAAATACCGCAAGCCGCACACCACGGCCTCGGAAGCCGATCTCAAAC
AATTTGACTTTGAAGACATTGATTATCCCATCCCCCCCGCGAGCCCCCTCAACAGCCCCTCACTTACCCGGTCCA
TTGACTTTGACTCTGTCGATCACATTGAAGACATGCCCACGCCAAACAAGGCGGCCAGATCGGCGGCTCAGCGGG
ACATGGCGGTTGTCCCATCCCAGGAGCCTGACAGTGAGCCAATTGAGGAGCAAGCTCAGCTCACGGCTCCTGAAC
CTCCGCCGACACCCCTTGAAATCTACGCCACGGTGACTGCTGAACTGCACATATTCGAGCCACAGCCAGGACACT
TTGCCATGGTGGACGACTCAGTCATTGCCACAATCTCGGAAGTGGGGAAATGGGAATACTGGCTGCAAGTTGACG
GCAAGGGTAAACATTGGCTAGGAACGCCGCTTGTTGCTGATATCAACCCTATTTTCGATTTTGAATATCTCTCAT
TTGTATTCAACTACTTCAGCAAGGACGGTACAGCCAGATCCTGGCTCTTGCGCTTTAAGGACCAGCCAACCTTGG
AGAAGGCTCAGCAGGCAGTGTTGCAGGCCATTTGGGAGAGACTCAACGAGACCAAGTGGGCAAAGATTCAAGAAA
AGGAGCGCGAGTACGTGCTCGATAGCTTTGCCGATTTGGCCATGGAAGACGCCCCTGAGCATCAAGAAGAGGAAG
AGGAGGAGGATGAATCGCCAGTCGACGACGAGGACGACCAGGGCGTGCACAGTGAAGCCTATGATTCGGAGGATG
ATGAGCACGCTGAGCAAGAGAGAAACCAAGGCGACGTCAACTCGCAATTGGCTGTTGGCTACAAGCACGATCGGT
CCTTTGTTGTGCGCGGCTCCAAGATTGGCGTCTTTTCACATACCGACGACAATCGCCTCAAGTTTGCCACGAATA
TCTCAAAGGTGACGACTCCAAACGGAAAGCTCATGAGTCCCAAGAAGGTGATGCTGCATAGCGAGGACCGGGATC
TCATCATGCAAAACCGGGTGGATCCCAATAAGCTTTACCGTATGGATATTGAGTACGGCAAGGTGGTTGACGAGT
GGAACGTTCACGACGACGTGCCCGTTGTCAACTTTGCCCCCGAGAACAAGTTTGCGCAAATGACTGCTGAGCAAA
CGTTTCTTGGTATTTCCAATAATGCGCTCTATCGCATCGACCCGCGTCTGTCTGGAAACAAGCTCGTCGACACAG
ACATGAAGCAGTATGCATCGAAAAACGACTTTTCAGCTCTTGCCACGACGGAAAAGGGCTACATTGCCGTGGCGA
GCAACAAGGGCGACATTCGCCTATTTGACCGCCTGGGCATCCGGGCAAAGACGCAACTTCCCGCCCTGGGCGATC
CCATTATCGGCATGGACGTGTCGGCGGATGGCCGGTGGATTCTGGGAACAACAAAGAACTACTTGCTGCTCATTG
ACGCACAGCAAAAGGGCGGCAAGAATGAGGGTAAGCTGGGATTCGAAAGGGCCTTTTCCGCCGACTCGAAGCCCC
ATCCGCGCCGCCTCGGCCTGACGCCCGAACACGTTGCGCAGTTTCATTACGAAACCGGCAAGCCGGTATCCTTTA
CGCCCGCAAAGTTCAACACGGGTGCCGGCGCCGAGGAAACGAGCATCATTACCGCCACGGGGCCCTACATCATTG
AATGGAACCTGAAGCGCCTGCTGCGCAGCCCCAAGGGCGCGTACAAGATTAAGCGCTACCAGGAAGACGTGCAGG
CCGACGACTTTAAATTCGGGTCTGACAAAAACGTCATTGTTGCCCTGCCAAACGAGGTCAACATGGTGGCCAAGC
AGAGTCTGCGCCGCCCCACGCGTGAGAGCCTCGTTGGAAATGGCCTGGGTGTCGGCGCGGTGCGGCGAAGCTCGG
CGCGTATTGGGACGAGGGAGAGCGGGCGATATAAGCTTGGCAAGGATGATATTGTGAATGCGCCTTATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail