Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|273
Gene name
LocationContig_1059:4034..4847
Strand-
Gene length (bp)813
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00646 F-box F-box domain 5.9E-05 21 55

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2522
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|273 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5367
Ophiocordyceps camponoti-floridani Ophcf2|01334
Ophiocordyceps camponoti-rufipedis Ophun1|6946
Ophiocordyceps kimflemingae Ophio5|1463
Ophiocordyceps subramaniannii Hirsu2|3689

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|273
MESRALALRPRCATVHAPSLECLPNELLLLVLSHLDVDDLLSTSRTSHLLRRLSLLPILHALRLRRARLLLPPLL
SSPSRPSRADLIARQVFLTPTSLISRRLARNLVSIRLARRLAARPDPHALALRAVLPRECIPGLASPVCVAPALV
ASRRAVERARIHNHLKRWVEAHWQHRVDEHAKSVARADETLGTGRVWRLTRYWERVAKGEPRILG*
Coding >OphauG2|273
ATGGAGTCGCGGGCCCTGGCGCTGCGGCCGCGGTGCGCTACCGTGCACGCGCCGTCGCTCGAGTGTTTGCCAAAC
GAGCTGCTGCTGCTTGTTCTGAGCCATCTCGACGTGGACGACTTGCTGTCTACGTCTCGGACCAGCCACCTCCTC
CGCCGCCTCTCCCTCCTCCCCATCCTGCACGCCCTCCGCCTCCGCCGCGCTCGCCTCCTCCTCCCGCCGCTTCTC
TCCTCGCCCTCGCGCCCCTCGCGCGCCGACCTCATTGCCCGCCAGGTCTTCCTGACGCCTACGTCGCTCATCTCG
CGCCGGCTGGCTCGCAACCTTGTTTCCATCCGGCTTGCCCGCCGCCTCGCCGCCCGCCCTGACCCCCATGCCCTC
GCCCTCCGCGCCGTCTTGCCTCGCGAATGCATCCCCGGCCTCGCCTCCCCCGTCTGCGTCGCCCCCGCCCTCGTC
GCGTCCAGGCGCGCCGTCGAACGCGCCCGCATCCACAATCACTTGAAGCGCTGGGTCGAGGCCCATTGGCAGCAT
CGCGTCGACGAGCATGCGAAAAGCGTCGCAAGGGCCGATGAAACCCTGGGCACGGGGCGTGTGTGGCGACTCACT
CGCTATTGGGAGCGTGTTGCCAAGGGCGAGCCTCGCATTTTGGGTTGA
Transcript >OphauG2|273
ATGGAGTCGCGGGCCCTGGCGCTGCGGCCGCGGTGCGCTACCGTGCACGCGCCGTCGCTCGAGTGTTTGCCAAAC
GAGCTGCTGCTGCTTGTTCTGAGCCATCTCGACGTGGACGACTTGCTGTCTACGTCTCGGACCAGCCACCTCCTC
CGCCGCCTCTCCCTCCTCCCCATCCTGCACGCCCTCCGCCTCCGCCGCGCTCGCCTCCTCCTCCCGCCGCTTCTC
TCCTCGCCCTCGCGCCCCTCGCGCGCCGACCTCATTGCCCGCCAGGTCTTCCTGACGCCTACGTCGCTCATCTCG
CGCCGGCTGGCTCGCAACCTTGTTTCCATCCGGCTTGCCCGCCGCCTCGCCGCCCGCCCTGACCCCCATGCCCTC
GCCCTCCGCGCCGTCTTGCCTCGCGAATGCATCCCCGGCCTCGCCTCCCCCGTCTGCGTCGCCCCCGCCCTCGTC
GCGTCCAGGCGCGCCGTCGAACGCGCCCGCATCCACAATCACTTGAAGCGCTGGGTCGAGGCCCATTGGCAGCAT
CGCGTCGACGAGCATGCGAAAAGCGTCGCAAGGGCCGATGAAACCCTGGGCACGGGGCGTGTGTGGCGACTCACT
CGCTATTGGGAGCGTGTTGCCAAGGGCGAGCCTCGCATTTTGGGTTGA
Gene >OphauG2|273
ATGGAGTCGCGGGCCCTGGCGCTGCGGCCGCGGTGCGCTACCGTGCACGCGCCGTCGCTCGAGTGTTTGCCAAAC
GAGCTGCTGCTGCTTGTTCTGAGCCATCTCGACGTGGACGACTTGCTGTCTACGTCTCGGGTATGCGCGCCCGCC
GTGATGCTTCTCGTCTCTCTCAACTTGGATCCCTTGACATCCCATGCTCCAGAAATGACCAAATCCCTCTCCCTC
CATCTCGCTTCCACCGCCCTCGCCCACCTCCGAAAAAATAAAACCGAAAAAAACAAAATCGCTTACATCTTCTAG
ACCAGCCACCTCCTCCGCCGCCTCTCCCTCCTCCCCATCCTGCACGCCCTCCGCCTCCGCCGCGCTCGCCTCCTC
CTCCCGCCGCTTCTCTCCTCGCCCTCGCGCCCCTCGCGCGCCGACCTCATTGCCCGCCAGGTCTTCCTGACGCCT
ACGTCGCTCATCTCGCGCCGGCTGGCTCGCAACCTTGTTTCCATCCGGCTTGCCCGCCGCCTCGCCGCCCGCCCT
GACCCCCATGCCCTCGCCCTCCGCGCCGTCTTGCCTCGCGAATGCATCCCCGGCCTCGCCTCCCCCGTCTGCGTC
GCCCCCGCCCTCGTCGCGTCCAGGCGCGCCGTCGAACGCGCCCGCATCCACAATCACTTGAAGCGCTGGGTCGAG
GCCCATTGGCAGCATCGCGTCGACGAGCATGCGAAAAGCGTCGCAAGGGCCGATGAAACCCTGGGCACGGGGCGT
GTGTGGCGACTCACTCGCTATTGGGAGCGTGTTGCCAAGGGCGAGCCTCGCATTTTGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail