Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2726
Gene name
LocationContig_202:7159..8635
Strand+
Gene length (bp)1476
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07571 TAF6_C TAF6 C-terminal HEAT repeat domain 5.4E-26 290 382
PF02969 TAF TATA box binding protein associated factor (TAF) 4.3E-17 18 80

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74462|TAF6_SCHPO Transcription initiation factor TFIID subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf6 PE=1 SV=1 17 397 1.0E-114
sp|P53040|TAF6_YEAST Transcription initiation factor TFIID subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF6 PE=1 SV=1 17 377 5.0E-84
sp|Q9MAU3|TAF6_ARATH Transcription initiation factor TFIID subunit 6 OS=Arabidopsis thaliana GN=TAF6 PE=1 SV=1 21 391 1.0E-71
sp|Q91857|TAF6_XENLA Transcription initiation factor TFIID subunit 6 OS=Xenopus laevis GN=taf6 PE=2 SV=3 10 381 4.0E-54
sp|P49848|TAF6_HUMAN Transcription initiation factor TFIID subunit 6 OS=Homo sapiens GN=TAF6 PE=1 SV=1 20 382 1.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74462|TAF6_SCHPO Transcription initiation factor TFIID subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf6 PE=1 SV=1 17 397 1.0E-114
sp|P53040|TAF6_YEAST Transcription initiation factor TFIID subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF6 PE=1 SV=1 17 377 5.0E-84
sp|Q9MAU3|TAF6_ARATH Transcription initiation factor TFIID subunit 6 OS=Arabidopsis thaliana GN=TAF6 PE=1 SV=1 21 391 1.0E-71
sp|Q91857|TAF6_XENLA Transcription initiation factor TFIID subunit 6 OS=Xenopus laevis GN=taf6 PE=2 SV=3 10 381 4.0E-54
sp|P49848|TAF6_HUMAN Transcription initiation factor TFIID subunit 6 OS=Homo sapiens GN=TAF6 PE=1 SV=1 20 382 1.0E-52
sp|Q63801|TAF6_RAT Transcription initiation factor TFIID subunit 6 OS=Rattus norvegicus GN=Taf6 PE=1 SV=1 20 382 1.0E-52
sp|Q62311|TAF6_MOUSE Transcription initiation factor TFIID subunit 6 OS=Mus musculus GN=Taf6 PE=1 SV=1 20 382 1.0E-52
sp|F4HVA6|TAF6B_ARATH Transcription initiation factor TFIID subunit 6b OS=Arabidopsis thaliana GN=TAF6B PE=1 SV=1 21 455 3.0E-52
sp|P49847|TAF6_DROME Transcription initiation factor TFIID subunit 6 OS=Drosophila melanogaster GN=Taf6 PE=1 SV=2 19 382 6.0E-46
sp|Q8R2K4|TAF6L_MOUSE TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Mus musculus GN=Taf6l PE=2 SV=1 21 376 1.0E-24
sp|Q9Y6J9|TAF6L_HUMAN TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens GN=TAF6L PE=1 SV=1 21 376 3.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0006352 DNA-templated transcription, initiation Yes
GO:0046483 heterocycle metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0009987 cellular process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1964
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2726 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6872
Ophiocordyceps camponoti-floridani Ophcf2|01587
Ophiocordyceps camponoti-rufipedis Ophun1|958
Ophiocordyceps kimflemingae Ophio5|3274
Ophiocordyceps subramaniannii Hirsu2|2136

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2726
MTTTSIDPPATGKQRLLWNSENARDVAESVGINGLSDEAQKALTQDIEYRIGQVIAEGMRLMRAARRTELTVGDV
TLALRVLDVEPLYGYDSTRPLRYGEASLGPGQPLFYLEDEEVDFEKIINAPLPRVSRDMMYTVHWLAIEGVQPSI
PQNPTLHESRTQDMLPKGPGAHPSLAALAGNDTGLNKPSVKHVVSKELILYFDKIQAALLDENPDDEVVRLRHAA
LGSVRDDPGLHQLVPYFVNFIMDRVTHHLDDIFTLHRMMELTTALIENQSLFLDPYASSLSSSTLTCLMARKLGS
EDGPDALARQYELRQLSASLVGRIACKYAASNTLLRPKLTRTCLKYLLDPTRPAAVLYGAISGLLEAGGPEAVRV
LVLRNLKAFDAGILQPLREKAEGSMDYEMLVQGLVQAVASLASSSQEADGDNAPATEAELEALNSFIGPIIGQRA
ASFGNRRLIKVILDARYLD*
Coding >OphauG2|2726
ATGACAACCACATCGATTGACCCCCCCGCGACTGGCAAACAGCGCTTGCTCTGGAATTCGGAAAATGCCCGTGAC
GTTGCCGAGTCGGTGGGCATTAACGGGCTCAGCGACGAGGCACAAAAGGCCCTGACCCAAGATATAGAGTACCGC
ATTGGCCAGGTCATTGCCGAGGGCATGCGTCTGATGCGGGCAGCGCGTCGCACCGAGTTGACGGTGGGAGATGTG
ACGCTTGCTCTGCGCGTGCTGGACGTGGAGCCGCTCTATGGCTACGACTCGACACGGCCACTGCGCTATGGCGAG
GCCAGTCTTGGGCCAGGCCAGCCGCTGTTCTACCTCGAGGATGAAGAGGTGGATTTTGAAAAGATTATCAATGCC
CCGTTGCCCAGAGTATCGCGAGACATGATGTATACTGTCCACTGGCTTGCCATTGAAGGCGTCCAGCCTTCTATC
CCCCAGAACCCAACCCTCCATGAATCGCGCACCCAAGACATGCTGCCCAAGGGCCCCGGCGCCCATCCATCTCTC
GCTGCCCTCGCTGGCAATGACACGGGCCTCAACAAGCCATCCGTCAAGCACGTCGTCAGCAAAGAGCTCATTTTG
TACTTTGACAAGATCCAAGCCGCCTTGCTCGACGAGAACCCCGATGACGAGGTGGTGCGTCTGCGTCACGCCGCC
CTCGGCTCTGTACGCGACGACCCTGGCCTCCACCAGCTCGTGCCGTACTTTGTCAACTTCATCATGGACCGCGTG
ACGCATCATCTGGACGACATCTTTACCTTGCATCGCATGATGGAGCTTACAACGGCCCTGATTGAGAACCAAAGC
CTGTTCCTCGATCCTTATGCCAGCTCTCTCTCCTCTTCCACCTTGACTTGTCTGATGGCTCGGAAGCTCGGCTCT
GAGGATGGCCCGGATGCGCTTGCACGCCAGTACGAGCTGCGCCAACTGTCCGCCTCTCTTGTCGGCCGCATTGCC
TGCAAGTATGCAGCGTCGAATACACTGCTGCGCCCCAAGTTGACCCGCACATGCCTCAAGTATCTGCTGGATCCC
ACTCGTCCGGCGGCTGTACTCTACGGTGCCATTTCTGGCTTGTTGGAGGCTGGCGGGCCCGAAGCTGTGCGCGTC
TTGGTACTACGCAACCTCAAGGCTTTTGACGCTGGCATCCTGCAGCCGCTGCGCGAAAAGGCCGAAGGCAGTATG
GACTATGAGATGCTGGTGCAGGGGCTTGTGCAAGCGGTTGCATCACTAGCAAGCTCCTCACAAGAGGCTGATGGC
GATAATGCACCAGCAACCGAGGCTGAGCTGGAAGCACTAAATAGCTTCATCGGGCCTATAATTGGGCAACGGGCT
GCGTCGTTTGGCAACCGCCGACTCATTAAAGTCATTCTCGATGCTCGATACCTTGACTAG
Transcript >OphauG2|2726
ATGACAACCACATCGATTGACCCCCCCGCGACTGGCAAACAGCGCTTGCTCTGGAATTCGGAAAATGCCCGTGAC
GTTGCCGAGTCGGTGGGCATTAACGGGCTCAGCGACGAGGCACAAAAGGCCCTGACCCAAGATATAGAGTACCGC
ATTGGCCAGGTCATTGCCGAGGGCATGCGTCTGATGCGGGCAGCGCGTCGCACCGAGTTGACGGTGGGAGATGTG
ACGCTTGCTCTGCGCGTGCTGGACGTGGAGCCGCTCTATGGCTACGACTCGACACGGCCACTGCGCTATGGCGAG
GCCAGTCTTGGGCCAGGCCAGCCGCTGTTCTACCTCGAGGATGAAGAGGTGGATTTTGAAAAGATTATCAATGCC
CCGTTGCCCAGAGTATCGCGAGACATGATGTATACTGTCCACTGGCTTGCCATTGAAGGCGTCCAGCCTTCTATC
CCCCAGAACCCAACCCTCCATGAATCGCGCACCCAAGACATGCTGCCCAAGGGCCCCGGCGCCCATCCATCTCTC
GCTGCCCTCGCTGGCAATGACACGGGCCTCAACAAGCCATCCGTCAAGCACGTCGTCAGCAAAGAGCTCATTTTG
TACTTTGACAAGATCCAAGCCGCCTTGCTCGACGAGAACCCCGATGACGAGGTGGTGCGTCTGCGTCACGCCGCC
CTCGGCTCTGTACGCGACGACCCTGGCCTCCACCAGCTCGTGCCGTACTTTGTCAACTTCATCATGGACCGCGTG
ACGCATCATCTGGACGACATCTTTACCTTGCATCGCATGATGGAGCTTACAACGGCCCTGATTGAGAACCAAAGC
CTGTTCCTCGATCCTTATGCCAGCTCTCTCTCCTCTTCCACCTTGACTTGTCTGATGGCTCGGAAGCTCGGCTCT
GAGGATGGCCCGGATGCGCTTGCACGCCAGTACGAGCTGCGCCAACTGTCCGCCTCTCTTGTCGGCCGCATTGCC
TGCAAGTATGCAGCGTCGAATACACTGCTGCGCCCCAAGTTGACCCGCACATGCCTCAAGTATCTGCTGGATCCC
ACTCGTCCGGCGGCTGTACTCTACGGTGCCATTTCTGGCTTGTTGGAGGCTGGCGGGCCCGAAGCTGTGCGCGTC
TTGGTACTACGCAACCTCAAGGCTTTTGACGCTGGCATCCTGCAGCCGCTGCGCGAAAAGGCCGAAGGCAGTATG
GACTATGAGATGCTGGTGCAGGGGCTTGTGCAAGCGGTTGCATCACTAGCAAGCTCCTCACAAGAGGCTGATGGC
GATAATGCACCAGCAACCGAGGCTGAGCTGGAAGCACTAAATAGCTTCATCGGGCCTATAATTGGGCAACGGGCT
GCGTCGTTTGGCAACCGCCGACTCATTAAAGTCATTCTCGATGCTCGATACCTTGACTAG
Gene >OphauG2|2726
ATGACAACCACATCGATTGACCCCCCCGCGACTGGCAAACAGCGCTTGCTCTGGAATTCGGAAAATGCCCGTGAC
GTTGCCGAGTCGGTGGGCATTAACGGGCTCAGCGACGAGGCACAAAAGGCCCTGACCCAAGATATAGAGTACCGC
ATTGGCCAGGTCATTGCCGAGGGCATGCGTCTGATGCGGGCAGCGCGTCGCACCGAGTTGACGGTGGGAGATGTG
ACGCTTGCTCTGCGCGTGCTGGACGTGGAGCCGCTCTATGGCTACGACTCGACACGGCCACTGCGCTATGGCGAG
GCCAGTCTTGGGCCAGGCCAGCCGCTGTTCTACCTCGAGGATGAAGAGGTGGATTTTGAAAAGATTATCAATGCC
CCGTTGCCCAGAGTATCGCGAGACATGATGTATACTGGTTCGTCTCTTGGCCCTCTGCTCCGCCATGCTTGATGG
AGTTGGAGTCGCTAATCATGGCCAAAAGTCCACTGGCTTGCCATTGAAGGCGTCCAGCCTTCTATCCCCCAGAAC
CCAACCCTCCATGAATCGCGCACCCAAGACATGCTGCCCAAGGGCCCCGGCGCCCATCCATCTCTCGCTGCCCTC
GCTGGCAATGACACGGGCCTCAACAAGCCATCCGTCAAGCACGTCGTCAGCAAAGAGCTCATTTTGTACTTTGAC
AAGATCCAAGCCGCCTTGCTCGACGAGAACCCCGATGACGAGGTGGTGCGTCTGCGTCACGCCGCCCTCGGCTCT
GTACGCGACGACCCTGGCCTCCACCAGCTCGTGCCGTACTTTGTCAACTTCATCATGGACCGCGTGACGCATCAT
CTGGACGACATCTTTACCTTGCATCGCATGATGGAGCTTACAACGGCCCTGATTGAGAACCAAAGCCTGTTCCTC
GATCCTTATGCCAGCTCTCTCTCCTCTTCCACCTTGACTTGTCTGATGGCTCGGAAGCTCGGCTCTGAGGATGGC
CCGGATGCGCTTGCACGCCAGTACGAGCTGCGCCAACTGTCCGCCTCTCTTGTCGGCCGCATTGCCTGCAAGTAT
GCAGCGTCGAATACACTGCTGCGCCCCAAGTTGACCCGCACATGCCTCAAGTATCTGCTGGATCCCACTCGTCCG
GCGGCTGTACTCTACGGTGCCATTTCTGGCTTGTTGGAGGCTGGCGGGCCCGAAGCTGTGCGCGTCTTGGTACTA
CGCAACCTCAAGGCTTTTGACGCTGGCATCCTGCAGCCGCTGCGCGAAAAGGCCGAAGGCAGTATGGACTATGAG
ATGCTGGTGCAGGGGCTTGTGCAAGCGGTTGCATCACTAGCAAGCTCCTCACAAGAGGCTGATGGCGATAATGCA
CCAGCAACCGAGGCTGAGCTGGAAGCACTAAATAGCTTCATCGGGCCTATAATTGGGCAACGGGCTGCGTCGTTT
GGCAACCGCCGACTCATTAAAGTCATTCTCGATGCTCGATACCTTGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail