Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2720
Gene name
LocationContig_2014:282..1209
Strand-
Gene length (bp)927
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 1.0E-07 101 125
PF13499 EF-hand_7 EF-hand domain pair 8.0E-10 66 124
PF13833 EF-hand_8 EF-hand domain pair 5.3E-08 76 125
PF13833 EF-hand_8 EF-hand domain pair 1.4E-02 133 155
PF13202 EF-hand_5 EF hand 2.5E-02 105 121
PF13202 EF-hand_5 EF hand 3.9E-04 134 152
PF13202 EF-hand_5 EF hand 1.6E-02 199 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O75340|PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 64 224 1.0E-44
sp|P12815|PDCD6_MOUSE Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 64 224 1.0E-44
sp|Q94743|SORCN_SCHJA Sorcin OS=Schistosoma japonicum PE=2 SV=1 63 221 5.0E-43
sp|Q8BFY6|PEF1_MOUSE Peflin OS=Mus musculus GN=Pef1 PE=1 SV=1 32 221 2.0E-41
sp|Q641Z8|PEF1_RAT Peflin OS=Rattus norvegicus GN=Pef1 PE=2 SV=1 34 221 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O75340|PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 64 224 1.0E-44
sp|P12815|PDCD6_MOUSE Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 64 224 1.0E-44
sp|Q94743|SORCN_SCHJA Sorcin OS=Schistosoma japonicum PE=2 SV=1 63 221 5.0E-43
sp|Q8BFY6|PEF1_MOUSE Peflin OS=Mus musculus GN=Pef1 PE=1 SV=1 32 221 2.0E-41
sp|Q641Z8|PEF1_RAT Peflin OS=Rattus norvegicus GN=Pef1 PE=2 SV=1 34 221 1.0E-40
sp|Q9UBV8|PEF1_HUMAN Peflin OS=Homo sapiens GN=PEF1 PE=1 SV=1 54 221 1.0E-39
sp|Q5PQ53|PEF1_XENLA Peflin OS=Xenopus laevis GN=pef1 PE=1 SV=1 52 227 2.0E-39
sp|Q6DC93|PEF1_DANRE Peflin OS=Danio rerio GN=pef1 PE=2 SV=1 61 227 3.0E-37
sp|Q6P069|SORCN_MOUSE Sorcin OS=Mus musculus GN=Sri PE=1 SV=1 77 224 5.0E-28
sp|Q8W4L0|CML49_ARATH Probable calcium-binding protein CML49 OS=Arabidopsis thaliana GN=CML49 PE=2 SV=1 61 224 5.0E-28
sp|P05044|SORCN_CRIGR Sorcin OS=Cricetulus griseus GN=SRI PE=1 SV=1 77 224 2.0E-27
sp|Q5R4U9|SORCN_PONAB Sorcin OS=Pongo abelii GN=SRI PE=2 SV=1 77 224 3.0E-27
sp|P30626|SORCN_HUMAN Sorcin OS=Homo sapiens GN=SRI PE=1 SV=1 77 224 3.0E-27
sp|Q9FYE4|CML50_ARATH Probable calcium-binding protein CML50 OS=Arabidopsis thaliana GN=CML50 PE=2 SV=1 55 224 1.0E-26
sp|P28676|GRAN_HUMAN Grancalcin OS=Homo sapiens GN=GCA PE=1 SV=2 34 224 5.0E-26
sp|Q8VC88|GRAN_MOUSE Grancalcin OS=Mus musculus GN=Gca PE=1 SV=1 60 224 1.0E-25
sp|Q5RAI6|GRAN_PONAB Grancalcin OS=Pongo abelii GN=GCA PE=2 SV=1 34 224 1.0E-24
sp|P53238|PEF1_YEAST Peflin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEF1 PE=1 SV=2 23 224 4.0E-24
sp|Q9D7J7|CPNS2_MOUSE Calpain small subunit 2 OS=Mus musculus GN=Capns2 PE=2 SV=1 21 220 1.0E-19
sp|Q96L46|CPNS2_HUMAN Calpain small subunit 2 OS=Homo sapiens GN=CAPNS2 PE=2 SV=2 20 220 1.0E-19
sp|P13135|CPNS1_BOVIN Calpain small subunit 1 OS=Bos taurus GN=CAPNS1 PE=2 SV=1 95 220 7.0E-19
sp|P04574|CPNS1_PIG Calpain small subunit 1 OS=Sus scrofa GN=CAPNS1 PE=1 SV=1 23 220 1.0E-18
sp|P04632|CPNS1_HUMAN Calpain small subunit 1 OS=Homo sapiens GN=CAPNS1 PE=1 SV=1 23 220 7.0E-18
sp|Q9ZQH1|CML48_ARATH Probable calcium-binding protein CML48 OS=Arabidopsis thaliana GN=CML48 PE=2 SV=2 1 224 1.0E-17
sp|P06813|CPNS1_RABIT Calpain small subunit 1 OS=Oryctolagus cuniculus GN=CAPNS1 PE=1 SV=1 23 220 1.0E-17
sp|O88456|CPNS1_MOUSE Calpain small subunit 1 OS=Mus musculus GN=Capns1 PE=1 SV=1 95 220 2.0E-17
sp|Q64537|CPNS1_RAT Calpain small subunit 1 OS=Rattus norvegicus GN=Capns1 PE=1 SV=3 23 220 3.0E-17
sp|Q11002|CANA_DROME Calpain-A OS=Drosophila melanogaster GN=CalpA PE=1 SV=2 84 224 7.0E-17
sp|Q92177|CAN3_CHICK Calpain-3 OS=Gallus gallus GN=CAPN3 PE=2 SV=1 95 220 1.0E-15
sp|Q9VT65|CANB_DROME Calpain-B OS=Drosophila melanogaster GN=CalpB PE=1 SV=2 48 224 2.0E-15
sp|P20807|CAN3_HUMAN Calpain-3 OS=Homo sapiens GN=CAPN3 PE=1 SV=2 37 220 4.0E-15
sp|Q9GLG7|CAN3_MACFA Calpain-3 OS=Macaca fascicularis GN=CAPN3 PE=2 SV=1 45 220 5.0E-15
sp|P16259|CAN3_RAT Calpain-3 OS=Rattus norvegicus GN=Capn3 PE=2 SV=1 44 220 7.0E-15
sp|Q64691|CAN3_MOUSE Calpain-3 OS=Mus musculus GN=Capn3 PE=2 SV=2 45 220 1.0E-14
sp|Q9TTH8|CAN3_SHEEP Calpain-3 OS=Ovis aries GN=CAPN3 PE=2 SV=1 23 220 3.0E-14
sp|P43368|CAN3_PIG Calpain-3 OS=Sus scrofa GN=CAPN3 PE=2 SV=2 30 220 3.0E-14
sp|P51186|CAN3_BOVIN Calpain-3 OS=Bos taurus GN=CAPN3 PE=2 SV=2 23 220 6.0E-14
sp|P06815|CAN1_RABIT Calpain-1 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN1 PE=1 SV=1 38 213 7.0E-14
sp|O35350|CAN1_MOUSE Calpain-1 catalytic subunit OS=Mus musculus GN=Capn1 PE=1 SV=1 94 220 7.0E-14
sp|P97571|CAN1_RAT Calpain-1 catalytic subunit OS=Rattus norvegicus GN=Capn1 PE=1 SV=1 94 220 7.0E-14
sp|Q9GLG2|CAN1_MACFA Calpain-1 catalytic subunit OS=Macaca fascicularis GN=CAPN1 PE=2 SV=1 95 220 3.0E-13
sp|Q5NVS7|CAN1_PONAB Calpain-1 catalytic subunit OS=Pongo abelii GN=CAPN1 PE=2 SV=1 95 220 3.0E-13
sp|P07384|CAN1_HUMAN Calpain-1 catalytic subunit OS=Homo sapiens GN=CAPN1 PE=1 SV=1 95 220 3.0E-13
sp|P35750|CAN1_PIG Calpain-1 catalytic subunit OS=Sus scrofa GN=CAPN1 PE=2 SV=3 95 220 3.0E-13
sp|Q95YL5|PEFA_DICDI Penta-EF hand domain-containing protein 1 OS=Dictyostelium discoideum GN=pefA PE=1 SV=1 64 215 3.0E-13
sp|Q27970|CAN1_BOVIN Calpain-1 catalytic subunit OS=Bos taurus GN=CAPN1 PE=1 SV=3 94 220 6.0E-13
sp|O14815|CAN9_HUMAN Calpain-9 OS=Homo sapiens GN=CAPN9 PE=1 SV=1 100 221 8.0E-13
sp|O08529|CAN2_MOUSE Calpain-2 catalytic subunit OS=Mus musculus GN=Capn2 PE=1 SV=4 95 221 2.0E-12
sp|Q92178|CAN2_CHICK Calpain-2 catalytic subunit OS=Gallus gallus GN=CAPN2 PE=2 SV=3 95 220 2.0E-12
sp|P06814|CAN2_RABIT Calpain-2 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN2 PE=1 SV=1 95 221 7.0E-12
sp|Q9GLG1|CAN2_MACFA Calpain-2 catalytic subunit OS=Macaca fascicularis GN=CAPN2 PE=2 SV=3 95 221 1.0E-11
sp|Q27971|CAN2_BOVIN Calpain-2 catalytic subunit OS=Bos taurus GN=CAPN2 PE=2 SV=2 95 221 1.0E-11
sp|P17655|CAN2_HUMAN Calpain-2 catalytic subunit OS=Homo sapiens GN=CAPN2 PE=1 SV=6 95 221 1.0E-11
sp|P27730|CAN_SCHMA Calpain OS=Schistosoma mansoni PE=2 SV=1 61 220 1.0E-11
sp|Q07009|CAN2_RAT Calpain-2 catalytic subunit OS=Rattus norvegicus GN=Capn2 PE=1 SV=3 95 221 1.0E-11
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 26 187 2.0E-11
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 27 225 2.0E-11
sp|Q6J756|CAN11_MOUSE Calpain-11 OS=Mus musculus GN=Capn11 PE=1 SV=1 84 220 2.0E-11
sp|P00789|CANX_CHICK Calpain-1 catalytic subunit OS=Gallus gallus PE=1 SV=2 95 220 3.0E-11
sp|Q9D805|CAN9_MOUSE Calpain-9 OS=Mus musculus GN=Capn9 PE=2 SV=2 100 221 4.0E-11
sp|Q78EJ9|CAN8_RAT Calpain-8 OS=Rattus norvegicus GN=Capn8 PE=2 SV=1 95 224 7.0E-11
sp|Q91VA3|CAN8_MOUSE Calpain-8 OS=Mus musculus GN=Capn8 PE=1 SV=1 71 224 1.0E-10
sp|P43367|CAN2_PIG Calpain-2 catalytic subunit (Fragment) OS=Sus scrofa GN=CAPN2 PE=2 SV=2 95 221 2.0E-10
sp|Q4V8Q1|CAN11_RAT Calpain 11 OS=Rattus norvegicus GN=Capn11 PE=2 SV=2 95 220 3.0E-10
sp|O35920|CAN9_RAT Calpain-9 OS=Rattus norvegicus GN=Capn9 PE=2 SV=2 100 221 4.0E-10
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 82 212 4.0E-10
sp|A6NHC0|CAN8_HUMAN Calpain-8 OS=Homo sapiens GN=CAPN8 PE=2 SV=3 93 224 8.0E-10
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 68 194 8.0E-10
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 82 212 2.0E-09
sp|Q95YL4|PEFB_DICDI Penta-EF hand domain-containing protein 2 OS=Dictyostelium discoideum GN=pefB PE=1 SV=1 68 215 3.0E-09
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 82 212 2.0E-08
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 68 207 6.0E-08
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 68 188 7.0E-08
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 82 215 9.0E-08
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 82 212 1.0E-07
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 82 212 1.0E-07
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 68 207 2.0E-07
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 68 188 2.0E-07
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 82 225 3.0E-07
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 68 189 5.0E-07
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 68 225 5.0E-07
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 68 189 6.0E-07
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 68 189 6.0E-07
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 68 189 6.0E-07
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 132 213 6.0E-07
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 68 189 8.0E-07
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 68 189 8.0E-07
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 68 189 8.0E-07
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 68 189 8.0E-07
sp|Q9LE22|CML27_ARATH Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1 52 187 2.0E-06
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 68 193 3.0E-06
sp|Q2R1Z5|CML6_ORYSJ Putative calmodulin-like protein 6 OS=Oryza sativa subsp. japonica GN=CML6 PE=3 SV=1 68 202 3.0E-06
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 64 187 3.0E-06
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 68 193 4.0E-06
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 68 193 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2999
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2720 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2154
Ophiocordyceps camponoti-floridani Ophcf2|00257
Ophiocordyceps camponoti-rufipedis Ophun1|6178
Ophiocordyceps kimflemingae Ophio5|6398
Ophiocordyceps subramaniannii Hirsu2|5141

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2720
MAYNRPYNPDALPRFAEPDPPPASSRYDTKPPPPIPQASPPVEPRKQSRPPPSPGLDAKADPTLSPLFRAVDKDS
TGQLSEKELSAALVNGDWSAFDIQTIRMMIRMFDSDRNGTINFDEFCGLWSFLASWRTLFDRFDVDRSGNISLSE
FSDALVAFRYRLSPRFVELLFKTYDKRQEGVMSFDLFVQSCISLKRMTDVFKKYDSDRDGYITLSFEDFLSEILK
QLK*
Coding >OphauG2|2720
ATGGCATATAATAGACCATACAACCCCGACGCTCTACCCAGATTCGCCGAACCAGACCCCCCTCCAGCATCGTCG
CGCTATGACACGAAACCTCCCCCTCCCATCCCCCAAGCTTCCCCCCCCGTTGAACCGCGCAAACAGAGCCGCCCC
CCGCCATCGCCAGGACTCGACGCAAAGGCCGACCCGACTCTTTCCCCCCTCTTTCGCGCCGTCGATAAAGACTCA
ACGGGGCAACTCTCGGAAAAGGAACTCTCAGCCGCCCTCGTCAACGGCGACTGGTCCGCCTTTGACATTCAGACT
ATCCGCATGATGATTCGCATGTTTGACTCGGACCGCAATGGCACAATCAACTTTGATGAATTCTGCGGCCTGTGG
TCCTTTCTCGCTTCTTGGCGCACCCTGTTTGACCGCTTCGACGTTGACCGCAGCGGAAACATCTCCCTTTCCGAA
TTCTCAGACGCCCTCGTTGCCTTTCGCTATCGTCTTAGTCCGCGCTTTGTCGAGTTGCTCTTCAAGACGTATGAT
AAGCGCCAGGAAGGCGTCATGAGCTTCGACTTGTTTGTCCAGAGCTGTATTTCTCTCAAGCGCATGACGGACGTG
TTTAAAAAGTACGACTCTGATCGTGATGGCTACATTACCCTCAGCTTTGAAGACTTTTTGAGTGAGATTCTCAAG
CAGCTCAAATAG
Transcript >OphauG2|2720
ATGGCATATAATAGACCATACAACCCCGACGCTCTACCCAGATTCGCCGAACCAGACCCCCCTCCAGCATCGTCG
CGCTATGACACGAAACCTCCCCCTCCCATCCCCCAAGCTTCCCCCCCCGTTGAACCGCGCAAACAGAGCCGCCCC
CCGCCATCGCCAGGACTCGACGCAAAGGCCGACCCGACTCTTTCCCCCCTCTTTCGCGCCGTCGATAAAGACTCA
ACGGGGCAACTCTCGGAAAAGGAACTCTCAGCCGCCCTCGTCAACGGCGACTGGTCCGCCTTTGACATTCAGACT
ATCCGCATGATGATTCGCATGTTTGACTCGGACCGCAATGGCACAATCAACTTTGATGAATTCTGCGGCCTGTGG
TCCTTTCTCGCTTCTTGGCGCACCCTGTTTGACCGCTTCGACGTTGACCGCAGCGGAAACATCTCCCTTTCCGAA
TTCTCAGACGCCCTCGTTGCCTTTCGCTATCGTCTTAGTCCGCGCTTTGTCGAGTTGCTCTTCAAGACGTATGAT
AAGCGCCAGGAAGGCGTCATGAGCTTCGACTTGTTTGTCCAGAGCTGTATTTCTCTCAAGCGCATGACGGACGTG
TTTAAAAAGTACGACTCTGATCGTGATGGCTACATTACCCTCAGCTTTGAAGACTTTTTGAGTGAGATTCTCAAG
CAGCTCAAATAG
Gene >OphauG2|2720
ATGGCATATAATAGACCATACAACCCCGACGCTCTACCCAGGTAAACCGCATTCCTCTCCCCTAAAAAACAAAGA
CACAACTAACCTTTTACCAGATTCGCCGAACCAGACCCCGTACGCCCTCGTCCCCTTCCCGCCCTCTTCAATATA
CATCTAACTTGCTCGTTCCTCGCCAGCCTCCAGCATCGTCGCGCTATGACACGAAACCTCCCCCTCCCATCCCCC
AAGCTTCCCCCCCCGTTGAACCGCGCAAACAGAGCCGCCCCCCGCCATCGCCAGGACTCGACGCAAAGGCCGACC
CGACTCTTTCCCCCCTCTTTCGCGCCGTCGATAAAGACTGTGCGTTTTTGTTTTTTTTTGGCCCTTGTTTAAAAT
ATCCTCCCTTTTTTTTTCTTGGGGTCCCCCTTCGATATTTTGCCCCTCCTTTTTCCTTTGCTGATATCATTTTGC
TCTCGTCAAATAGCAACGGGGCAACTCTCGGAAAAGGAACTCTCAGCCGCCCTCGTCAACGGCGACTGGTCCGCC
TTTGACATTCAGACTATCCGCATGATGATTCGCATGTTTGACTCGGACCGCAATGGCACAATCAACTTTGATGAA
TTCTGCGGCCTGTGGTCCTTTCTCGCTTCTTGGCGCACCCTGTTTGACCGCTTCGACGTTGACCGCAGCGGAAAC
ATCTCCCTTTCCGAATTCTCAGACGCCCTCGTTGCCTTTCGCTATCGTCTTAGTCCGCGCTTTGTCGAGTTGCTC
TTCAAGACGTATGATAAGCGCCAGGAAGGCGTCATGAGCTTCGACTTGTTTGTCCAGAGCTGTATTTCTCTCAAG
CGCATGACGGACGTGTTTAAAAAGTACGACTCTGATCGTGATGGCTACATTACCCTCAGCTTTGAAGACTTTTTG
AGTGAGATTCTCAAGCAGCTCAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail