Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2716
Gene name
LocationContig_201:19861..22160
Strand+
Gene length (bp)2299
Transcript length (bp)2082
Coding sequence length (bp)2082
Protein length (aa) 694

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12513 SUV3_C Mitochondrial degradasome RNA helicase subunit C terminal 2.6E-12 635 676
PF00271 Helicase_C Helicase conserved C-terminal domain 5.6E-08 354 461
PF18147 Suv3_C_1 Suv3 C-terminal domain 1 2.1E-05 560 597

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94445|SUV3_SCHPO ATP-dependent RNA helicase suv3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=suv3 PE=3 SV=1 158 677 2.0E-110
sp|P32580|SUV3_YEAST ATP-dependent RNA helicase SUV3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUV3 PE=1 SV=2 121 676 3.0E-108
sp|Q10D00|SUV3M_ORYSJ ATP-dependent RNA helicase SUV3, mitochondrial OS=Oryza sativa subsp. japonica GN=SUV3 PE=1 SV=1 175 676 7.0E-105
sp|O74727|SUV3_SACPA ATP-dependent RNA helicase SUV3, mitochondrial OS=Saccharomyces paradoxus GN=SUV3 PE=3 SV=1 176 676 7.0E-104
sp|Q9SMX1|SUV3M_ARATH DExH-box ATP-dependent RNA helicase DExH16, mitochondrial OS=Arabidopsis thaliana GN=SUV3 PE=1 SV=1 175 671 2.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94445|SUV3_SCHPO ATP-dependent RNA helicase suv3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=suv3 PE=3 SV=1 158 677 2.0E-110
sp|P32580|SUV3_YEAST ATP-dependent RNA helicase SUV3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUV3 PE=1 SV=2 121 676 3.0E-108
sp|Q10D00|SUV3M_ORYSJ ATP-dependent RNA helicase SUV3, mitochondrial OS=Oryza sativa subsp. japonica GN=SUV3 PE=1 SV=1 175 676 7.0E-105
sp|O74727|SUV3_SACPA ATP-dependent RNA helicase SUV3, mitochondrial OS=Saccharomyces paradoxus GN=SUV3 PE=3 SV=1 176 676 7.0E-104
sp|Q9SMX1|SUV3M_ARATH DExH-box ATP-dependent RNA helicase DExH16, mitochondrial OS=Arabidopsis thaliana GN=SUV3 PE=1 SV=1 175 671 2.0E-103
sp|Q59TB2|SUV3_CANAL ATP-dependent RNA helicase SUV3, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SUV3 PE=3 SV=1 172 676 4.0E-101
sp|F4KFV7|SUV3L_ARATH DExH-box ATP-dependent RNA helicase DExH18, mitochondrial OS=Arabidopsis thaliana GN=At5g39840 PE=3 SV=1 177 676 2.0E-94
sp|Q5ZJT0|SUV3_CHICK ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Gallus gallus GN=SUPV3L1 PE=2 SV=1 173 664 2.0E-88
sp|Q9VN03|SUV3_DROME ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila melanogaster GN=CG9791 PE=2 SV=3 104 674 3.0E-87
sp|Q8IYB8|SUV3_HUMAN ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens GN=SUPV3L1 PE=1 SV=1 167 664 8.0E-87
sp|Q7X745|SUV3L_ORYSJ ATP-dependent RNA helicase SUV3L, mitochondrial OS=Oryza sativa subsp. japonica GN=LOC_Os04g38630 PE=2 SV=2 177 655 4.0E-86
sp|Q01IJ3|SUV3L_ORYSI ATP-dependent RNA helicase SUV3L, mitochondrial OS=Oryza sativa subsp. indica GN=H0219H12.4 PE=3 SV=1 177 655 4.0E-86
sp|A4IG62|SUV3_DANRE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Danio rerio GN=supv3l1 PE=2 SV=1 173 663 4.0E-85
sp|Q5EBA1|SUV3_RAT ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Rattus norvegicus GN=Supv3l1 PE=2 SV=1 173 679 4.0E-85
sp|Q295E6|SUV3_DROPS ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA22038 PE=3 SV=1 104 606 4.0E-84
sp|Q61SU7|SUV3_CAEBR ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG06022 PE=3 SV=3 35 662 1.0E-83
sp|Q80YD1|SUV3_MOUSE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Mus musculus GN=Supv3l1 PE=1 SV=1 173 674 1.0E-83
sp|Q17828|SUV3_CAEEL ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Caenorhabditis elegans GN=C08F8.2 PE=3 SV=2 160 674 9.0E-83
[Show less]

GO

GO Term Description Terminal node
GO:0016817 hydrolase activity, acting on acid anhydrides Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3402
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2716 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5631
Ophiocordyceps camponoti-floridani Ophcf2|06283
Ophiocordyceps camponoti-rufipedis Ophun1|4969
Ophiocordyceps kimflemingae Ophio5|1717
Ophiocordyceps subramaniannii Hirsu2|6366

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2716
MKAWTQAATWRAAATVARKRSLFTTLQPQHNDGSTFQKRWTPPPQKIPKKEVFSQARDALNKRLKLPNKKWGAPL
SDELLSRYVVKQMPSLAQSLTPYMQKHVGLDEHKIEESLKKFSKTLINARSMLIKTSPAYKRIRQAATLQEITNE
LIYQFQCVAFEHVISKDTEQVQKRLMDMSHPPEWFPATRTIERTIHCHVGPTNSGKTYTALQALEKSRRGVYAGP
LRLLAAEVYNRMIAKGRACALYTGEEVRIPTHTDQYLTSCTAEMVPLNRRFDVAVIDEIQLIGNDQRGNAWTTAL
LGVQATEVHVCGEERTLPIIKALCRSMGDKCIVHEYQRLSPLKTLHKTISKLSKLEKGDAVIGFSRITLHQLKRR
IEMDTGRRCAIIYGSMPPEVRAQQAALFNDPSNEYDFLVGSDAIGMGLNLEIRRIIFDKVVKFDGVKLSAITVPE
IKQIGGRAGRFRTARSAINAVDSPGDSGSREKVGFVTTRDPKDLKLVQEAFKTAPPLITKAMIEPPAGLVEQVSK
LYPRGTPLQFILMGISEAAKTSDLYDMQVTRDMMEIAGVIEEIPLTIHDRLTLTRMPVNLRLPSNIEVLQALGRI
IAENKPGDLLKIAEIPLCTLDMAPGNESGGRMEYLERLEELHIALNQYIWLSYRYSGVFRDQGMAFHARSLVEEK
LIVQNQYCFHQGLVMKRM*
Coding >OphauG2|2716
ATGAAAGCCTGGACCCAAGCAGCAACTTGGAGAGCTGCTGCCACCGTCGCGCGCAAACGGTCTCTATTCACAACT
CTGCAACCGCAGCACAATGATGGCTCAACGTTCCAAAAGAGATGGACCCCTCCGCCGCAAAAAATTCCAAAAAAA
GAGGTCTTTTCCCAGGCTCGAGATGCATTAAACAAGAGATTGAAACTCCCAAACAAGAAATGGGGAGCCCCCCTT
TCAGACGAGCTGCTGAGTCGCTACGTCGTGAAACAGATGCCGTCTCTCGCCCAATCTCTGACTCCGTATATGCAG
AAGCATGTCGGACTCGATGAGCACAAGATTGAGGAATCGTTAAAGAAATTCAGCAAAACACTTATAAACGCCCGT
TCCATGTTGATCAAAACTTCACCTGCGTATAAGAGAATACGCCAGGCCGCCACGTTGCAGGAAATCACCAATGAG
TTGATCTATCAATTTCAGTGCGTTGCCTTTGAACATGTTATTTCAAAGGACACGGAACAGGTGCAGAAAAGATTG
ATGGACATGAGCCATCCCCCCGAGTGGTTTCCTGCCACTAGAACCATCGAGCGCACCATACACTGCCACGTGGGA
CCGACAAACTCTGGAAAAACATACACAGCACTCCAGGCACTCGAAAAGTCGAGACGAGGCGTGTATGCCGGGCCT
CTTCGGCTGCTGGCTGCCGAAGTTTATAATCGCATGATTGCAAAAGGGCGCGCGTGTGCACTCTATACTGGCGAA
GAAGTTCGCATTCCTACCCACACGGACCAATATCTGACGAGCTGCACAGCCGAAATGGTTCCTCTCAACAGGCGC
TTCGATGTTGCCGTGATTGACGAAATTCAATTAATTGGCAACGACCAACGAGGCAATGCTTGGACAACGGCTCTT
CTCGGCGTGCAGGCCACTGAAGTTCACGTCTGTGGCGAAGAGCGCACACTGCCCATTATCAAAGCACTTTGCCGC
AGCATGGGCGACAAGTGTATTGTCCACGAGTACCAGCGTCTGAGCCCTCTAAAAACGTTGCATAAAACCATAAGC
AAACTGTCGAAACTGGAAAAGGGGGATGCCGTGATTGGTTTCAGCCGCATAACCCTCCATCAGCTCAAGCGCCGA
ATTGAAATGGACACTGGCCGTCGATGCGCCATTATTTATGGCTCTATGCCTCCTGAAGTGCGCGCTCAACAGGCT
GCTCTTTTTAACGATCCCAGCAATGAATATGACTTCTTGGTAGGCAGCGATGCCATTGGCATGGGACTCAATCTG
GAAATCCGGCGCATCATCTTCGACAAGGTTGTCAAATTTGATGGCGTCAAGCTTTCTGCTATCACCGTGCCAGAG
ATTAAACAGATTGGCGGAAGAGCAGGCCGCTTCCGCACAGCACGGAGCGCCATCAATGCAGTCGACTCGCCTGGC
GATTCTGGCAGCAGGGAAAAGGTTGGCTTTGTCACCACCAGAGACCCTAAAGATCTCAAGCTGGTTCAAGAAGCA
TTCAAAACAGCCCCTCCACTGATTACAAAAGCCATGATTGAGCCGCCGGCTGGGTTGGTCGAACAAGTCTCCAAA
TTGTATCCGCGCGGAACGCCGTTGCAATTTATTCTCATGGGCATATCCGAGGCAGCAAAGACGAGCGACCTGTAT
GACATGCAAGTGACGAGGGACATGATGGAGATTGCGGGAGTAATTGAGGAAATTCCACTCACCATCCACGACAGA
CTCACCCTTACTCGCATGCCTGTCAACCTCCGCCTTCCTAGCAACATTGAAGTGCTACAGGCACTGGGGCGCATT
ATAGCGGAGAACAAGCCGGGCGATTTGCTAAAGATTGCCGAGATTCCGCTTTGCACTCTTGACATGGCTCCTGGT
AATGAATCAGGAGGCAGGATGGAGTACCTGGAGCGGTTGGAAGAGCTGCACATTGCGCTCAACCAGTACATTTGG
CTGTCGTACCGATATTCAGGAGTGTTTAGAGACCAGGGCATGGCATTCCATGCTCGGTCTCTGGTTGAGGAGAAG
CTGATTGTCCAGAACCAGTACTGCTTCCACCAGGGATTAGTGATGAAGAGGATGTAG
Transcript >OphauG2|2716
ATGAAAGCCTGGACCCAAGCAGCAACTTGGAGAGCTGCTGCCACCGTCGCGCGCAAACGGTCTCTATTCACAACT
CTGCAACCGCAGCACAATGATGGCTCAACGTTCCAAAAGAGATGGACCCCTCCGCCGCAAAAAATTCCAAAAAAA
GAGGTCTTTTCCCAGGCTCGAGATGCATTAAACAAGAGATTGAAACTCCCAAACAAGAAATGGGGAGCCCCCCTT
TCAGACGAGCTGCTGAGTCGCTACGTCGTGAAACAGATGCCGTCTCTCGCCCAATCTCTGACTCCGTATATGCAG
AAGCATGTCGGACTCGATGAGCACAAGATTGAGGAATCGTTAAAGAAATTCAGCAAAACACTTATAAACGCCCGT
TCCATGTTGATCAAAACTTCACCTGCGTATAAGAGAATACGCCAGGCCGCCACGTTGCAGGAAATCACCAATGAG
TTGATCTATCAATTTCAGTGCGTTGCCTTTGAACATGTTATTTCAAAGGACACGGAACAGGTGCAGAAAAGATTG
ATGGACATGAGCCATCCCCCCGAGTGGTTTCCTGCCACTAGAACCATCGAGCGCACCATACACTGCCACGTGGGA
CCGACAAACTCTGGAAAAACATACACAGCACTCCAGGCACTCGAAAAGTCGAGACGAGGCGTGTATGCCGGGCCT
CTTCGGCTGCTGGCTGCCGAAGTTTATAATCGCATGATTGCAAAAGGGCGCGCGTGTGCACTCTATACTGGCGAA
GAAGTTCGCATTCCTACCCACACGGACCAATATCTGACGAGCTGCACAGCCGAAATGGTTCCTCTCAACAGGCGC
TTCGATGTTGCCGTGATTGACGAAATTCAATTAATTGGCAACGACCAACGAGGCAATGCTTGGACAACGGCTCTT
CTCGGCGTGCAGGCCACTGAAGTTCACGTCTGTGGCGAAGAGCGCACACTGCCCATTATCAAAGCACTTTGCCGC
AGCATGGGCGACAAGTGTATTGTCCACGAGTACCAGCGTCTGAGCCCTCTAAAAACGTTGCATAAAACCATAAGC
AAACTGTCGAAACTGGAAAAGGGGGATGCCGTGATTGGTTTCAGCCGCATAACCCTCCATCAGCTCAAGCGCCGA
ATTGAAATGGACACTGGCCGTCGATGCGCCATTATTTATGGCTCTATGCCTCCTGAAGTGCGCGCTCAACAGGCT
GCTCTTTTTAACGATCCCAGCAATGAATATGACTTCTTGGTAGGCAGCGATGCCATTGGCATGGGACTCAATCTG
GAAATCCGGCGCATCATCTTCGACAAGGTTGTCAAATTTGATGGCGTCAAGCTTTCTGCTATCACCGTGCCAGAG
ATTAAACAGATTGGCGGAAGAGCAGGCCGCTTCCGCACAGCACGGAGCGCCATCAATGCAGTCGACTCGCCTGGC
GATTCTGGCAGCAGGGAAAAGGTTGGCTTTGTCACCACCAGAGACCCTAAAGATCTCAAGCTGGTTCAAGAAGCA
TTCAAAACAGCCCCTCCACTGATTACAAAAGCCATGATTGAGCCGCCGGCTGGGTTGGTCGAACAAGTCTCCAAA
TTGTATCCGCGCGGAACGCCGTTGCAATTTATTCTCATGGGCATATCCGAGGCAGCAAAGACGAGCGACCTGTAT
GACATGCAAGTGACGAGGGACATGATGGAGATTGCGGGAGTAATTGAGGAAATTCCACTCACCATCCACGACAGA
CTCACCCTTACTCGCATGCCTGTCAACCTCCGCCTTCCTAGCAACATTGAAGTGCTACAGGCACTGGGGCGCATT
ATAGCGGAGAACAAGCCGGGCGATTTGCTAAAGATTGCCGAGATTCCGCTTTGCACTCTTGACATGGCTCCTGGT
AATGAATCAGGAGGCAGGATGGAGTACCTGGAGCGGTTGGAAGAGCTGCACATTGCGCTCAACCAGTACATTTGG
CTGTCGTACCGATATTCAGGAGTGTTTAGAGACCAGGGCATGGCATTCCATGCTCGGTCTCTGGTTGAGGAGAAG
CTGATTGTCCAGAACCAGTACTGCTTCCACCAGGGATTAGTGATGAAGAGGATGTAG
Gene >OphauG2|2716
ATGAAAGCCTGGACCCAAGCAGCAACTTGGAGAGCTGCTGCCACCGTCGCGCGCAAACGGTCTCTATTCACAACT
CTGCAACCGCAGCACAATGATGGCTCAACGTTCCAAAAGAGATGGACCCCTCCGCCGCAAAAAATTCCAAAAAAA
GAGGTCTTTTCCCAGGCTCGAGATGCATTAAACAAGGTATGGACTAAGAAAGATGAGATGCCGACATGAAAACGC
CGCCGTCTGACAAGCCATGCAGAGATTGAAACTCCCAAACAAGAAATGGGGAGCCCCCCTTTCAGACGAGCTGCT
GAGTCGCTACGTCGTGAAACAGATGCCGTCTCTCGCCCAATCTCTGACTCCGTATATGCAGAAGCATGTCGGACT
CGATGAGCACAAGATTGAGGAATCGTTAAAGAAATTCAGCAAAACACTTATAAACGCCCGTTCCATGTTGATCAA
AACTTCACCTGCGTATAAGAGAATACGCCAGGCCGCCACGTTGCAGGAAATCACCAATGAGTTGATCTATCAATT
TCAGTGCGTTGCCTTTGAACATGTTATTTCAAAGGACACGGAACAGGTGCAGAAAAGATTGATGGACATGAGCCA
TCCCCCCGAGTGGTTTCCTGCCACTAGAACCATCGAGCGCACCATACACTGCCACGTGGGACCGACAAACTCTGG
AAAAACATACACAGCACTCCAGGCACTCGAAAAGTCGAGACGAGGCGTGTATGCCGGGCCTCTTCGGCTGCTGGC
TGCCGAAGTTTATAATCGCATGATTGCAAAAGGGCGCGCGTGTGCACTCTATACTGGCGAAGAAGTTCGCATTCC
TACCCACACGGACCAATATCTGACGAGCTGCACAGCCGAAATGGTTCCTCTCAACAGGCGCTTCGATGTTGCCGT
GATTGACGAAATTCAATTAATTGGCAACGACCAACGAGGCAATGCTTGGACAACGGCTCTTCTCGGCGTGCAGGC
CACTGAAGTTCACGTCTGTGGCGAAGAGCGCACACTGCCCATTATCAAAGCACTTTGCCGCAGCATGGGCGACAA
GTGTATTGTCCACGAGTACCAGCGTCTGAGCCCTCTAAAAACGTTGCATAAAACCATAAGCAAACTGTCGAAACT
GGAAAAGGGGGATGCCGTGATTGGTTTCAGCCGCATAACCCTCCATCAGCTCAAGCGCCGAATTGAAATGGACAC
TGGCCGTCGATGCGCCATTATTTATGGCTCTATGCCTCCTGAAGTGCGCGCTCAACAGGCTGCTCTTTTTAACGA
TCCCAGCAATGAATATGACTTCTTGGTAGGCAGCGATGCCATTGGCATGGGACTCAATCTGGAAATCCGGCGCAT
CATCTTCGACAAGGTTGTCAAATTTGATGGCGTCAAGCTTTCTGCTATCACCGTGCCAGAGATTAAACAGATTGG
CGGAAGAGCAGGCCGCTTCCGCACAGCACGGAGCGCCATCAATGCAGTCGACTCGCCTGGCGATTCTGGCAGCAG
GGAAAAGGTTGGCTTTGTCACCACCAGAGACCCTAAAGATCTCAAGCTGGTTCAAGAAGCATTCAAAACAGCCCC
TCCACTGATTACAAAAGCCATGATTGAGCCGCCGGCTGGGTTGGTCGAACAAGTCTCCAAATTGTATCCGCGCGG
AACGCCGTTGCAATTTATTCTCATGGGCATATCCGAGGCAGCAAAGACGAGCGACCTGTATGACATGCAAGTGAC
GAGGGACATGATGGAGATTGCGGGAGTAATTGAGGAAATTCCACTCACCATCCACGACAGACTCACCCTTACTCG
CATGCCTGTCAACCTCCGCCTTCCTAGCAACATTGAAGTGCTACAGGCACTGGGGCGCATTATAGCGGAGAACAA
GCCGGGCGATTTGCTAAAGATTGCCGAGATTCCGCTTTGCACTCTTGACATGGCTCCTGGTAATGAATCAGGAGG
CAGGATGGAGTACCTGGAGCGGTTGGAAGAGCTGCACATTGCGCTCAACCAGTACATTTGGCTGTCGTACCGATA
TTCAGGAGTGTTTAGAGACCAGGGCATGGCATTCCATGCTCGGTCTCTGGTTGAGGAGAAGCTGATTGGTACGCT
TGATAGCCTCGACTATACTCGGTCGTACACTCGCCCCAAGAAGAAGACGCAAGAAGATGAATCGTGGTATGATGA
CATGAGTTGGCTGTTTAGTCCAGAACCAGTACTGCTTCCACCAGGGATTAGTGATGAAGAGGGTGTGTGCGATAA
GGAGCATATGACTATCTTGTGCTAAGGCTAATTATGTGACGAGATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail