Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2713
Gene name
LocationContig_201:15435..17782
Strand+
Gene length (bp)2347
Transcript length (bp)2286
Coding sequence length (bp)2286
Protein length (aa) 762

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05557 MAD Mitotic checkpoint protein 3.4E-60 91 754

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C452|MAD1_YARLI Spindle assembly checkpoint component MAD1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MAD1 PE=3 SV=1 52 752 9.0E-55
sp|P87169|MAD1_SCHPO Spindle assembly checkpoint component mad1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mad1 PE=3 SV=1 149 755 1.0E-46
sp|Q754Z1|MAD1_ASHGO Spindle assembly checkpoint component MAD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MAD1 PE=3 SV=2 247 748 1.0E-27
sp|Q6CMM2|MAD1_KLULA Spindle assembly checkpoint component MAD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MAD1 PE=3 SV=1 269 752 4.0E-26
sp|Q6BSY1|MAD1_DEBHA Spindle assembly checkpoint component MAD1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MAD1 PE=3 SV=2 404 752 9.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C452|MAD1_YARLI Spindle assembly checkpoint component MAD1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MAD1 PE=3 SV=1 52 752 9.0E-55
sp|P87169|MAD1_SCHPO Spindle assembly checkpoint component mad1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mad1 PE=3 SV=1 149 755 1.0E-46
sp|Q754Z1|MAD1_ASHGO Spindle assembly checkpoint component MAD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MAD1 PE=3 SV=2 247 748 1.0E-27
sp|Q6CMM2|MAD1_KLULA Spindle assembly checkpoint component MAD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MAD1 PE=3 SV=1 269 752 4.0E-26
sp|Q6BSY1|MAD1_DEBHA Spindle assembly checkpoint component MAD1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MAD1 PE=3 SV=2 404 752 9.0E-26
sp|Q874L7|MAD1_KLUDE Spindle assembly checkpoint component MAD1 OS=Kluyveromyces delphensis GN=MAD1 PE=3 SV=1 217 752 3.0E-24
sp|Q59PD6|MAD1_CANAL Spindle assembly checkpoint component MAD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAD1 PE=3 SV=2 289 752 2.0E-18
sp|Q9WTX8|MD1L1_MOUSE Mitotic spindle assembly checkpoint protein MAD1 OS=Mus musculus GN=Mad1l1 PE=1 SV=1 164 755 2.0E-18
sp|Q9Y6D9|MD1L1_HUMAN Mitotic spindle assembly checkpoint protein MAD1 OS=Homo sapiens GN=MAD1L1 PE=1 SV=2 198 755 3.0E-18
sp|Q6FS63|MAD1_CANGA Spindle assembly checkpoint component MAD1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MAD1 PE=3 SV=1 304 755 8.0E-16
sp|Q80YF0|MD1L1_CRIGR Mitotic spindle assembly checkpoint protein MAD1 OS=Cricetulus griseus GN=MAD1L1 PE=2 SV=1 239 755 9.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0007094 mitotic spindle assembly checkpoint signaling Yes
GO:1901991 negative regulation of mitotic cell cycle phase transition No
GO:0071173 spindle assembly checkpoint signaling No
GO:0033044 regulation of chromosome organization No
GO:0045786 negative regulation of cell cycle No
GO:0071174 mitotic spindle checkpoint signaling No
GO:1905819 negative regulation of chromosome separation No
GO:1901987 regulation of cell cycle phase transition No
GO:0045841 negative regulation of mitotic metaphase/anaphase transition No
GO:0008150 biological_process No
GO:0051784 negative regulation of nuclear division No
GO:0035556 intracellular signal transduction No
GO:0051783 regulation of nuclear division No
GO:0051726 regulation of cell cycle No
GO:1901988 negative regulation of cell cycle phase transition No
GO:0050789 regulation of biological process No
GO:0030071 regulation of mitotic metaphase/anaphase transition No
GO:0007165 signal transduction No
GO:0010639 negative regulation of organelle organization No
GO:0045930 negative regulation of mitotic cell cycle No
GO:0000075 cell cycle checkpoint signaling No
GO:0048519 negative regulation of biological process No
GO:1905818 regulation of chromosome separation No
GO:0033046 negative regulation of sister chromatid segregation No
GO:0050794 regulation of cellular process No
GO:0007088 regulation of mitotic nuclear division No
GO:1901990 regulation of mitotic cell cycle phase transition No
GO:0010564 regulation of cell cycle process No
GO:0031577 spindle checkpoint signaling No
GO:0022402 cell cycle process No
GO:0010965 regulation of mitotic sister chromatid separation No
GO:2000816 negative regulation of mitotic sister chromatid separation No
GO:0051129 negative regulation of cellular component organization No
GO:0045839 negative regulation of mitotic nuclear division No
GO:0033045 regulation of sister chromatid segregation No
GO:0033043 regulation of organelle organization No
GO:0051983 regulation of chromosome segregation No
GO:0033047 regulation of mitotic sister chromatid segregation No
GO:0048523 negative regulation of cellular process No
GO:0007346 regulation of mitotic cell cycle No
GO:1902100 negative regulation of metaphase/anaphase transition of cell cycle No
GO:2001251 negative regulation of chromosome organization No
GO:0051985 negative regulation of chromosome segregation No
GO:0065007 biological regulation No
GO:0007093 mitotic cell cycle checkpoint signaling No
GO:1902099 regulation of metaphase/anaphase transition of cell cycle No
GO:0009987 cellular process No
GO:1903047 mitotic cell cycle process No
GO:0033048 negative regulation of mitotic sister chromatid segregation No
GO:0010948 negative regulation of cell cycle process No
GO:0051128 regulation of cellular component organization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3400
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2713 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5628
Ophiocordyceps camponoti-floridani Ophcf2|06281
Ophiocordyceps camponoti-rufipedis Ophun1|4971
Ophiocordyceps kimflemingae Ophio5|1719
Ophiocordyceps subramaniannii Hirsu2|6364

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2713
MSSPPPQVSRARSGSMSSVLRPNPSLARPLTTFRSTIRNPQPAYNLITGEESSSQSPTRQSYAAESVRPGSRESS
KENMAPLDADEYEKYRRDIESLKAEIGTIQYRMQTAQQEHEITRSQQNNKLEQYRRREIEQSHLKQAAEAARTQA
EEQAAAAKKELDDLREAKESELAAAERRAREAQTEAHILQEQLDDLSSAKDQAARVAEKRFSDVQTQLTACQNSL
LELEQVNASKDTALQQAYSQAAEKEAQISQLEAQVLQLRAHSGDAEVVDKIKADLSEQVQHIRTLEKMNSEHLAE
LKKLRASSKAAEILEEEKRSLVRKLASAELLQEELAEARLQRQRLEDERLAWTSYLNLQQGQDAEFESPQDMARA
LAQERLTSASYMEQLGGLRAEMLIRENNIHSLQEEKAQLKEEISAARANADVASVDKARARLDRQRALAVKEAEF
LRLQLHNIDHEQQAMQPETYNQSTTLRLRELETLVDQYKAEVQALHTELLSMESIESGTPAKAAAAGIKRAHSQD
DESHQEQLGQLNRKNRKLQDELAHVQTSLALAEKDLLSSREQLSAAKLQNQTRVLSLRSNPTSDHEAFKRSTLEA
LQKENHDLLATLRCKQRDPSIPLIPTSVLGAMEREIAAAKAETMSAQKSARRLKEVWSAKSQEFKEAIFSTLGWT
VTFIPNGKMRVESTFYPSQTDEHENSIVFDGERGTMKVGGGPKSAFARRIADQIGFWVREKGCIPGFLAALTLEF
YEEQNKTMRVD*
Coding >OphauG2|2713
ATGAGCAGCCCACCGCCACAAGTGTCTCGCGCTCGTAGCGGCTCCATGTCAAGCGTCTTGCGCCCCAACCCTTCG
TTGGCGCGCCCATTGACCACTTTTCGATCTACAATTCGGAACCCACAGCCGGCATATAATCTCATCACAGGCGAA
GAATCTTCATCACAATCACCAACACGCCAGAGCTATGCTGCCGAATCGGTCCGTCCCGGCTCGCGCGAGAGCTCC
AAGGAGAACATGGCTCCTCTGGATGCCGACGAGTACGAAAAATATAGAAGGGACATAGAGTCTTTAAAGGCTGAA
ATTGGCACCATTCAATATCGCATGCAAACCGCCCAACAAGAACACGAAATAACTCGCTCGCAACAAAACAACAAA
TTGGAGCAATATCGTCGCCGTGAAATCGAGCAAAGTCATCTCAAGCAAGCTGCCGAGGCGGCGCGTACACAGGCT
GAGGAGCAGGCTGCAGCGGCCAAGAAGGAATTGGACGACCTGCGCGAAGCCAAGGAATCTGAGCTAGCAGCGGCT
GAGCGTCGAGCGCGAGAAGCCCAGACCGAGGCTCATATCCTACAGGAACAGCTCGACGACCTATCCAGCGCCAAG
GATCAAGCTGCAAGAGTGGCAGAAAAGCGATTTTCTGATGTACAAACTCAACTAACAGCATGCCAAAATTCATTG
CTCGAGTTGGAGCAAGTTAATGCGTCCAAAGATACCGCTTTACAGCAAGCATACAGCCAAGCGGCCGAAAAAGAA
GCACAAATCTCACAGCTTGAAGCACAAGTGCTACAGCTCAGAGCACACAGTGGTGATGCCGAGGTTGTGGACAAG
ATCAAGGCGGACCTGTCAGAACAAGTGCAACATATTCGCACTCTCGAAAAGATGAATAGCGAGCATCTTGCAGAA
CTCAAGAAATTGAGAGCTTCTAGCAAAGCTGCCGAAATCCTTGAGGAGGAAAAAAGGTCCCTTGTGCGCAAGCTG
GCATCAGCGGAATTGCTTCAGGAGGAGCTTGCAGAGGCTCGTCTACAACGGCAGCGACTTGAAGATGAGCGGCTG
GCGTGGACAAGCTATTTGAACTTGCAACAAGGCCAAGATGCCGAGTTTGAATCTCCCCAAGACATGGCCCGGGCT
TTGGCCCAGGAACGCTTAACAAGCGCCTCCTACATGGAGCAGCTTGGTGGCTTACGTGCAGAGATGCTGATTCGC
GAAAATAATATTCATTCTCTACAAGAGGAAAAGGCACAGCTCAAGGAAGAAATTAGTGCGGCTAGGGCCAACGCA
GACGTTGCTTCAGTGGACAAGGCGCGAGCGCGACTCGATCGCCAGCGTGCCCTGGCAGTCAAGGAGGCCGAGTTT
CTGCGCCTACAACTCCATAATATTGACCATGAACAACAAGCAATGCAGCCAGAAACGTACAATCAGTCTACCACG
CTGCGCCTCAGGGAGCTGGAGACGCTAGTGGACCAGTACAAGGCTGAAGTTCAAGCCCTGCATACAGAGCTCTTG
TCCATGGAGTCGATTGAAAGTGGCACACCTGCAAAGGCAGCAGCAGCTGGCATCAAACGCGCACACTCGCAAGAT
GATGAATCGCACCAAGAGCAATTGGGCCAACTCAATCGCAAGAACCGCAAGCTACAAGACGAGCTGGCCCATGTG
CAGACAAGCCTGGCGCTGGCTGAAAAGGACCTTTTGTCGAGCCGAGAACAGCTGTCGGCTGCCAAGTTGCAGAAC
CAGACGCGAGTACTGTCGTTGCGCTCAAATCCAACATCGGACCACGAAGCCTTCAAGCGGAGCACGCTCGAGGCG
CTCCAAAAGGAGAATCATGATCTCTTGGCAACGCTGCGATGCAAGCAGCGCGACCCCTCGATTCCCCTAATCCCG
ACATCTGTTCTGGGTGCCATGGAGAGAGAGATTGCAGCAGCCAAGGCTGAGACGATGTCGGCACAAAAATCTGCA
CGGCGGCTCAAGGAGGTGTGGAGCGCCAAGTCGCAAGAGTTCAAGGAGGCCATCTTTTCCACGCTGGGCTGGACA
GTCACCTTTATACCCAACGGCAAGATGCGTGTTGAGAGCACCTTTTACCCTTCGCAGACGGACGAGCATGAAAAC
TCGATTGTATTTGACGGCGAGCGCGGCACAATGAAGGTTGGAGGCGGTCCCAAGAGTGCATTTGCGCGACGCATT
GCAGATCAGATTGGATTCTGGGTCCGGGAAAAGGGCTGCATACCGGGTTTCTTGGCAGCACTGACTCTTGAATTC
TACGAGGAGCAGAACAAGACGATGCGGGTAGACTAA
Transcript >OphauG2|2713
ATGAGCAGCCCACCGCCACAAGTGTCTCGCGCTCGTAGCGGCTCCATGTCAAGCGTCTTGCGCCCCAACCCTTCG
TTGGCGCGCCCATTGACCACTTTTCGATCTACAATTCGGAACCCACAGCCGGCATATAATCTCATCACAGGCGAA
GAATCTTCATCACAATCACCAACACGCCAGAGCTATGCTGCCGAATCGGTCCGTCCCGGCTCGCGCGAGAGCTCC
AAGGAGAACATGGCTCCTCTGGATGCCGACGAGTACGAAAAATATAGAAGGGACATAGAGTCTTTAAAGGCTGAA
ATTGGCACCATTCAATATCGCATGCAAACCGCCCAACAAGAACACGAAATAACTCGCTCGCAACAAAACAACAAA
TTGGAGCAATATCGTCGCCGTGAAATCGAGCAAAGTCATCTCAAGCAAGCTGCCGAGGCGGCGCGTACACAGGCT
GAGGAGCAGGCTGCAGCGGCCAAGAAGGAATTGGACGACCTGCGCGAAGCCAAGGAATCTGAGCTAGCAGCGGCT
GAGCGTCGAGCGCGAGAAGCCCAGACCGAGGCTCATATCCTACAGGAACAGCTCGACGACCTATCCAGCGCCAAG
GATCAAGCTGCAAGAGTGGCAGAAAAGCGATTTTCTGATGTACAAACTCAACTAACAGCATGCCAAAATTCATTG
CTCGAGTTGGAGCAAGTTAATGCGTCCAAAGATACCGCTTTACAGCAAGCATACAGCCAAGCGGCCGAAAAAGAA
GCACAAATCTCACAGCTTGAAGCACAAGTGCTACAGCTCAGAGCACACAGTGGTGATGCCGAGGTTGTGGACAAG
ATCAAGGCGGACCTGTCAGAACAAGTGCAACATATTCGCACTCTCGAAAAGATGAATAGCGAGCATCTTGCAGAA
CTCAAGAAATTGAGAGCTTCTAGCAAAGCTGCCGAAATCCTTGAGGAGGAAAAAAGGTCCCTTGTGCGCAAGCTG
GCATCAGCGGAATTGCTTCAGGAGGAGCTTGCAGAGGCTCGTCTACAACGGCAGCGACTTGAAGATGAGCGGCTG
GCGTGGACAAGCTATTTGAACTTGCAACAAGGCCAAGATGCCGAGTTTGAATCTCCCCAAGACATGGCCCGGGCT
TTGGCCCAGGAACGCTTAACAAGCGCCTCCTACATGGAGCAGCTTGGTGGCTTACGTGCAGAGATGCTGATTCGC
GAAAATAATATTCATTCTCTACAAGAGGAAAAGGCACAGCTCAAGGAAGAAATTAGTGCGGCTAGGGCCAACGCA
GACGTTGCTTCAGTGGACAAGGCGCGAGCGCGACTCGATCGCCAGCGTGCCCTGGCAGTCAAGGAGGCCGAGTTT
CTGCGCCTACAACTCCATAATATTGACCATGAACAACAAGCAATGCAGCCAGAAACGTACAATCAGTCTACCACG
CTGCGCCTCAGGGAGCTGGAGACGCTAGTGGACCAGTACAAGGCTGAAGTTCAAGCCCTGCATACAGAGCTCTTG
TCCATGGAGTCGATTGAAAGTGGCACACCTGCAAAGGCAGCAGCAGCTGGCATCAAACGCGCACACTCGCAAGAT
GATGAATCGCACCAAGAGCAATTGGGCCAACTCAATCGCAAGAACCGCAAGCTACAAGACGAGCTGGCCCATGTG
CAGACAAGCCTGGCGCTGGCTGAAAAGGACCTTTTGTCGAGCCGAGAACAGCTGTCGGCTGCCAAGTTGCAGAAC
CAGACGCGAGTACTGTCGTTGCGCTCAAATCCAACATCGGACCACGAAGCCTTCAAGCGGAGCACGCTCGAGGCG
CTCCAAAAGGAGAATCATGATCTCTTGGCAACGCTGCGATGCAAGCAGCGCGACCCCTCGATTCCCCTAATCCCG
ACATCTGTTCTGGGTGCCATGGAGAGAGAGATTGCAGCAGCCAAGGCTGAGACGATGTCGGCACAAAAATCTGCA
CGGCGGCTCAAGGAGGTGTGGAGCGCCAAGTCGCAAGAGTTCAAGGAGGCCATCTTTTCCACGCTGGGCTGGACA
GTCACCTTTATACCCAACGGCAAGATGCGTGTTGAGAGCACCTTTTACCCTTCGCAGACGGACGAGCATGAAAAC
TCGATTGTATTTGACGGCGAGCGCGGCACAATGAAGGTTGGAGGCGGTCCCAAGAGTGCATTTGCGCGACGCATT
GCAGATCAGATTGGATTCTGGGTCCGGGAAAAGGGCTGCATACCGGGTTTCTTGGCAGCACTGACTCTTGAATTC
TACGAGGAGCAGAACAAGACGATGCGGGTAGACTAA
Gene >OphauG2|2713
ATGAGCAGCCCACCGCCACAAGTGTCTCGCGCTCGTAGCGGCTCCATGTCAAGCGTCTTGCGCCCCAACCCTTCG
TTGGCGCGCCCATTGACCACTTTTCGAGCATGTCCTCAACTCCCAGTGCAATGCCAGCAGAGGACTCGTGACTGA
CCCTCTGCTTTAGTCTACAATTCGGAACCCACAGCCGGCATATAATCTCATCACAGGCGAAGAATCTTCATCACA
ATCACCAACACGCCAGAGCTATGCTGCCGAATCGGTCCGTCCCGGCTCGCGCGAGAGCTCCAAGGAGAACATGGC
TCCTCTGGATGCCGACGAGTACGAAAAATATAGAAGGGACATAGAGTCTTTAAAGGCTGAAATTGGCACCATTCA
ATATCGCATGCAAACCGCCCAACAAGAACACGAAATAACTCGCTCGCAACAAAACAACAAATTGGAGCAATATCG
TCGCCGTGAAATCGAGCAAAGTCATCTCAAGCAAGCTGCCGAGGCGGCGCGTACACAGGCTGAGGAGCAGGCTGC
AGCGGCCAAGAAGGAATTGGACGACCTGCGCGAAGCCAAGGAATCTGAGCTAGCAGCGGCTGAGCGTCGAGCGCG
AGAAGCCCAGACCGAGGCTCATATCCTACAGGAACAGCTCGACGACCTATCCAGCGCCAAGGATCAAGCTGCAAG
AGTGGCAGAAAAGCGATTTTCTGATGTACAAACTCAACTAACAGCATGCCAAAATTCATTGCTCGAGTTGGAGCA
AGTTAATGCGTCCAAAGATACCGCTTTACAGCAAGCATACAGCCAAGCGGCCGAAAAAGAAGCACAAATCTCACA
GCTTGAAGCACAAGTGCTACAGCTCAGAGCACACAGTGGTGATGCCGAGGTTGTGGACAAGATCAAGGCGGACCT
GTCAGAACAAGTGCAACATATTCGCACTCTCGAAAAGATGAATAGCGAGCATCTTGCAGAACTCAAGAAATTGAG
AGCTTCTAGCAAAGCTGCCGAAATCCTTGAGGAGGAAAAAAGGTCCCTTGTGCGCAAGCTGGCATCAGCGGAATT
GCTTCAGGAGGAGCTTGCAGAGGCTCGTCTACAACGGCAGCGACTTGAAGATGAGCGGCTGGCGTGGACAAGCTA
TTTGAACTTGCAACAAGGCCAAGATGCCGAGTTTGAATCTCCCCAAGACATGGCCCGGGCTTTGGCCCAGGAACG
CTTAACAAGCGCCTCCTACATGGAGCAGCTTGGTGGCTTACGTGCAGAGATGCTGATTCGCGAAAATAATATTCA
TTCTCTACAAGAGGAAAAGGCACAGCTCAAGGAAGAAATTAGTGCGGCTAGGGCCAACGCAGACGTTGCTTCAGT
GGACAAGGCGCGAGCGCGACTCGATCGCCAGCGTGCCCTGGCAGTCAAGGAGGCCGAGTTTCTGCGCCTACAACT
CCATAATATTGACCATGAACAACAAGCAATGCAGCCAGAAACGTACAATCAGTCTACCACGCTGCGCCTCAGGGA
GCTGGAGACGCTAGTGGACCAGTACAAGGCTGAAGTTCAAGCCCTGCATACAGAGCTCTTGTCCATGGAGTCGAT
TGAAAGTGGCACACCTGCAAAGGCAGCAGCAGCTGGCATCAAACGCGCACACTCGCAAGATGATGAATCGCACCA
AGAGCAATTGGGCCAACTCAATCGCAAGAACCGCAAGCTACAAGACGAGCTGGCCCATGTGCAGACAAGCCTGGC
GCTGGCTGAAAAGGACCTTTTGTCGAGCCGAGAACAGCTGTCGGCTGCCAAGTTGCAGAACCAGACGCGAGTACT
GTCGTTGCGCTCAAATCCAACATCGGACCACGAAGCCTTCAAGCGGAGCACGCTCGAGGCGCTCCAAAAGGAGAA
TCATGATCTCTTGGCAACGCTGCGATGCAAGCAGCGCGACCCCTCGATTCCCCTAATCCCGACATCTGTTCTGGG
TGCCATGGAGAGAGAGATTGCAGCAGCCAAGGCTGAGACGATGTCGGCACAAAAATCTGCACGGCGGCTCAAGGA
GGTGTGGAGCGCCAAGTCGCAAGAGTTCAAGGAGGCCATCTTTTCCACGCTGGGCTGGACAGTCACCTTTATACC
CAACGGCAAGATGCGTGTTGAGAGCACCTTTTACCCTTCGCAGACGGACGAGCATGAAAACTCGATTGTATTTGA
CGGCGAGCGCGGCACAATGAAGGTTGGAGGCGGTCCCAAGAGTGCATTTGCGCGACGCATTGCAGATCAGATTGG
ATTCTGGGTCCGGGAAAAGGGCTGCATACCGGGTTTCTTGGCAGCACTGACTCTTGAATTCTACGAGGAGCAGAA
CAAGACGATGCGGGTAGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail