Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2710
Gene name
LocationContig_201:6555..7926
Strand-
Gene length (bp)1371
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12588 PSDC Phophatidylserine decarboxylase 3.2E-49 53 190
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 7.8E-28 225 427

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 204 428 4.0E-16
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 221 427 4.0E-13
sp|A4VR22|PSD_PSEU5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 220 432 4.0E-12
sp|A0Q3R9|PSD_CLONN Phosphatidylserine decarboxylase proenzyme OS=Clostridium novyi (strain NT) GN=psd PE=3 SV=1 194 427 1.0E-11
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 205 427 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14111|PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psd3 PE=3 SV=2 204 428 4.0E-16
sp|A4GNA8|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana GN=PSD3 PE=1 SV=1 221 427 4.0E-13
sp|A4VR22|PSD_PSEU5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas stutzeri (strain A1501) GN=psd PE=3 SV=1 220 432 4.0E-12
sp|A0Q3R9|PSD_CLONN Phosphatidylserine decarboxylase proenzyme OS=Clostridium novyi (strain NT) GN=psd PE=3 SV=1 194 427 1.0E-11
sp|F4KAK5|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana GN=PSD2 PE=2 SV=1 205 427 4.0E-11
sp|B0V9W1|PSD_ACIBY Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AYE) GN=psd PE=3 SV=1 221 432 4.0E-11
sp|B7I242|PSD_ACIB5 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB0057) GN=psd PE=3 SV=1 221 432 4.0E-11
sp|B7GUX2|PSD_ACIB3 Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain AB307-0294) GN=psd PE=3 SV=1 221 432 4.0E-11
sp|A3MA23|PSD_ACIBT Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=psd PE=3 SV=2 221 432 5.0E-11
sp|B2I1N9|PSD_ACIBC Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain ACICU) GN=psd PE=3 SV=1 221 432 5.0E-11
sp|Q8RGF2|PSD_FUSNN Phosphatidylserine decarboxylase proenzyme OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=psd PE=3 SV=1 217 427 5.0E-11
sp|A9VHW5|PSD_BACWK Phosphatidylserine decarboxylase proenzyme OS=Bacillus weihenstephanensis (strain KBAB4) GN=psd PE=3 SV=1 208 428 6.0E-11
sp|B0VP52|PSD_ACIBS Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baumannii (strain SDF) GN=psd PE=3 SV=1 221 432 2.0E-10
sp|B7HCW5|PSD_BACC4 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain B4264) GN=psd PE=3 SV=1 206 428 2.0E-09
sp|Q730J7|PSD_BACC1 Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=psd PE=3 SV=2 206 428 2.0E-09
sp|Q818C6|PSD_BACCR Phosphatidylserine decarboxylase proenzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=psd PE=3 SV=1 206 428 2.0E-09
sp|Q5ZRA9|PSD_LEGPH Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=psd PE=3 SV=1 221 440 2.0E-09
sp|A8MJ83|PSD_ALKOO Phosphatidylserine decarboxylase proenzyme OS=Alkaliphilus oremlandii (strain OhILAs) GN=psd PE=3 SV=1 221 426 3.0E-09
sp|A5IIH5|PSD_LEGPC Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Corby) GN=psd PE=3 SV=1 221 440 4.0E-09
sp|B7GKA2|PSD_ANOFW Phosphatidylserine decarboxylase proenzyme OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=psd PE=3 SV=1 273 428 4.0E-09
sp|Q5JN42|PSD2_ORYSJ Phosphatidylserine decarboxylase proenzyme 2 OS=Oryza sativa subsp. japonica GN=PSD2 PE=3 SV=2 205 427 5.0E-09
sp|Q5WSH5|PSD_LEGPL Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Lens) GN=psd PE=3 SV=1 221 440 6.0E-09
sp|Q5X0Q0|PSD_LEGPA Phosphatidylserine decarboxylase proenzyme OS=Legionella pneumophila (strain Paris) GN=psd PE=3 SV=1 221 440 6.0E-09
sp|Q0SWT6|PSD_CLOPS Phosphatidylserine decarboxylase proenzyme OS=Clostridium perfringens (strain SM101 / Type A) GN=psd PE=3 SV=1 212 428 7.0E-09
sp|A7GT32|PSD_BACCN Phosphatidylserine decarboxylase proenzyme OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=psd PE=3 SV=1 265 426 1.0E-08
sp|Q6F6W3|PSD_ACIAD Phosphatidylserine decarboxylase proenzyme OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=psd PE=3 SV=1 221 432 2.0E-08
sp|A4G529|PSD_HERAR Phosphatidylserine decarboxylase proenzyme OS=Herminiimonas arsenicoxydans GN=psd PE=3 SV=1 212 428 2.0E-08
sp|Q2YB83|PSD_NITMU Phosphatidylserine decarboxylase proenzyme OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=psd PE=3 SV=1 229 427 3.0E-08
sp|Q21H90|PSD_SACD2 Phosphatidylserine decarboxylase proenzyme OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=psd PE=3 SV=1 196 426 6.0E-08
sp|Q47C25|PSD_DECAR Phosphatidylserine decarboxylase proenzyme OS=Dechloromonas aromatica (strain RCB) GN=psd PE=3 SV=1 212 428 1.0E-07
sp|Q4FQD5|PSD_PSYA2 Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=psd PE=3 SV=1 220 440 1.0E-07
sp|A6VD70|PSD_PSEA7 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain PA7) GN=psd PE=3 SV=1 271 436 2.0E-07
sp|Q9HUK8|PSD_PSEAE Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=psd PE=3 SV=1 271 425 2.0E-07
sp|Q02F61|PSD_PSEAB Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=psd PE=3 SV=1 271 425 2.0E-07
sp|B7V346|PSD_PSEA8 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas aeruginosa (strain LESB58) GN=psd PE=3 SV=1 271 425 2.0E-07
sp|A0KSQ8|PSD_SHESA Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain ANA-3) GN=psd PE=3 SV=1 220 443 3.0E-07
sp|Q07XV9|PSD_SHEFN Phosphatidylserine decarboxylase proenzyme OS=Shewanella frigidimarina (strain NCIMB 400) GN=psd PE=3 SV=1 221 439 3.0E-07
sp|Q9Z767|PSD_CHLPN Phosphatidylserine decarboxylase proenzyme OS=Chlamydia pneumoniae GN=psd PE=3 SV=1 217 424 3.0E-07
sp|Q0HR33|PSD_SHESR Phosphatidylserine decarboxylase proenzyme OS=Shewanella sp. (strain MR-7) GN=psd PE=3 SV=1 220 443 3.0E-07
sp|A3QAD1|PSD_SHELP Phosphatidylserine decarboxylase proenzyme OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=psd PE=3 SV=1 220 443 4.0E-07
sp|Q3KJ03|PSD_PSEPF Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf0-1) GN=psd PE=3 SV=1 220 433 6.0E-07
sp|A8H8H5|PSD_SHEPA Phosphatidylserine decarboxylase proenzyme OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=psd PE=3 SV=1 220 443 7.0E-07
sp|B0TU73|PSD_SHEHH Phosphatidylserine decarboxylase proenzyme OS=Shewanella halifaxensis (strain HAW-EB4) GN=psd PE=3 SV=1 220 443 8.0E-07
sp|A4XPX3|PSD_PSEMY Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas mendocina (strain ymp) GN=psd PE=3 SV=1 271 425 8.0E-07
sp|Q4KJ87|PSD_PSEF5 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=psd PE=3 SV=1 271 427 1.0E-06
sp|C3KDM6|PSD_PSEFS Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas fluorescens (strain SBW25) GN=psd PE=3 SV=1 220 440 1.0E-06
sp|Q1I433|PSD_PSEE4 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas entomophila (strain L48) GN=psd PE=3 SV=1 271 436 2.0E-06
sp|Q1Q8K8|PSD_PSYCK Phosphatidylserine decarboxylase proenzyme OS=Psychrobacter cryohalolentis (strain K5) GN=psd PE=3 SV=1 220 432 2.0E-06
sp|C5CU16|PSD_VARPS Phosphatidylserine decarboxylase proenzyme OS=Variovorax paradoxus (strain S110) GN=psd PE=3 SV=1 215 424 3.0E-06
sp|C1DLP2|PSD_AZOVD Phosphatidylserine decarboxylase proenzyme OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=psd PE=3 SV=1 271 447 3.0E-06
sp|Q88DB9|PSD_PSEPK Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain KT2440) GN=psd PE=3 SV=1 271 436 4.0E-06
sp|A5W9U4|PSD_PSEP1 Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=psd PE=3 SV=1 271 436 4.0E-06
sp|B1JAE9|PSD_PSEPW Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain W619) GN=psd PE=3 SV=1 271 436 4.0E-06
sp|Q0VMD7|PSD_ALCBS Phosphatidylserine decarboxylase proenzyme OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=psd PE=3 SV=1 265 424 7.0E-06
sp|B0KL10|PSD_PSEPG Phosphatidylserine decarboxylase proenzyme OS=Pseudomonas putida (strain GB-1) GN=psd PE=3 SV=1 271 427 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004609 phosphatidylserine decarboxylase activity Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0019637 organophosphate metabolic process No
GO:0044238 primary metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009987 cellular process No
GO:0090407 organophosphate biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0003674 molecular_function No
GO:0016830 carbon-carbon lyase activity No
GO:0016829 lyase activity No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0006629 lipid metabolic process No
GO:0016831 carboxy-lyase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup309
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2710 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5632
Ophiocordyceps australis map64 (Brazil) OphauB2|5656
Ophiocordyceps camponoti-floridani Ophcf2|00043
Ophiocordyceps camponoti-rufipedis Ophun1|6281
Ophiocordyceps kimflemingae Ophio5|2558
Ophiocordyceps subramaniannii Hirsu2|1125
Ophiocordyceps subramaniannii Hirsu2|3028
Ophiocordyceps subramaniannii Hirsu2|3864
Ophiocordyceps subramaniannii Hirsu2|989

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2710
MSHVIPIMPTRPLHHLTRIGGWLPENPNVLVDWLKGLVREVDGLRHAPNIAGPVQELKELIESTAELRMLASAMF
DEVPDKDPYRQDPMGNKQIRSYHHMLLIFQYVMMHVAPKWSMSETGAGLIGFPFNAVLDWPMATASGYAFFLKKE
VNLKLKKILDTWRDTVLTTEKSLVVLNEGQDGWLGPRPLAKIESDTNVTDHKSLKFHELFECNPDLPHWGFKSWD
DFFIRRFRNFDKIRPTMFKDCPEWIVNSCESKPFALQLKVKARDSFWLKGQPYSVSEMLDGHELADRFVGGTVYQ
AFLSATSYHRWNSPVSGRVVHSQIIDGTYFSEPTVTGFTSPDGPDPAAPDQAQGYITHVATRALVFIEAAPPVGL
MAVVYVGMSDVSSCEILPKFAASKLPVNVCKGDEIGMFHHGGSTHAMLFGKDVKLAWVAGAMPGALSHNLAIRSE
LAMVYK*
Coding >OphauG2|2710
ATGTCCCACGTTATTCCCATTATGCCGACTCGGCCTCTGCACCACTTGACCCGTATCGGCGGCTGGTTGCCCGAG
AACCCCAATGTTCTTGTCGACTGGCTCAAGGGCCTCGTCAGAGAGGTGGACGGTCTTCGCCACGCGCCCAACATC
GCGGGCCCCGTGCAGGAGCTCAAGGAGCTTATTGAAAGCACAGCCGAGCTGCGCATGCTGGCCTCGGCCATGTTT
GACGAAGTGCCAGACAAGGACCCCTACCGCCAGGACCCCATGGGCAACAAGCAGATCCGCAGCTATCACCACATG
CTCCTCATCTTCCAATACGTCATGATGCATGTGGCGCCGAAATGGAGCATGTCGGAGACGGGGGCGGGCTTGATT
GGCTTCCCGTTTAATGCGGTGCTCGACTGGCCCATGGCCACGGCCAGTGGATATGCCTTTTTCCTCAAGAAAGAG
GTGAATTTGAAGCTCAAAAAGATTCTCGACACGTGGCGCGACACCGTCTTGACGACGGAAAAGTCGCTTGTTGTG
TTGAATGAGGGCCAGGATGGCTGGCTGGGGCCGAGACCCTTGGCCAAAATCGAGAGCGACACCAACGTGACGGAC
CACAAGTCGCTCAAGTTCCACGAGCTGTTTGAGTGCAATCCCGACCTGCCGCACTGGGGCTTCAAGAGCTGGGAC
GATTTCTTCATCCGCCGGTTCCGCAACTTTGACAAGATTCGGCCCACCATGTTCAAAGACTGTCCCGAGTGGATT
GTCAACTCGTGCGAGTCCAAGCCCTTTGCGCTGCAGCTCAAGGTCAAGGCGAGAGATTCGTTTTGGCTCAAGGGA
CAGCCGTACTCGGTGAGCGAGATGCTCGACGGGCACGAGCTGGCTGATAGGTTTGTCGGCGGCACTGTCTACCAG
GCGTTTCTCAGCGCGACTTCGTATCATCGTTGGAACTCGCCCGTGTCGGGCAGAGTGGTGCATAGCCAGATTATT
GACGGGACATACTTTTCCGAGCCCACCGTCACTGGCTTCACTTCACCCGATGGACCTGACCCGGCGGCGCCCGAT
CAGGCCCAGGGCTATATTACGCATGTTGCAACGCGGGCTCTCGTTTTCATCGAGGCGGCGCCGCCAGTGGGCCTC
ATGGCGGTGGTCTATGTCGGCATGTCGGACGTCTCTTCGTGTGAGATTTTGCCAAAGTTTGCCGCGTCCAAGCTG
CCGGTCAATGTGTGTAAGGGAGATGAGATTGGCATGTTTCATCATGGGGGCTCGACGCATGCTATGCTCTTTGGA
AAGGATGTTAAGCTTGCCTGGGTTGCCGGCGCCATGCCGGGTGCTTTGAGTCATAATTTGGCTATACGTAGTGAG
CTGGCCATGGTCTACAAGTAG
Transcript >OphauG2|2710
ATGTCCCACGTTATTCCCATTATGCCGACTCGGCCTCTGCACCACTTGACCCGTATCGGCGGCTGGTTGCCCGAG
AACCCCAATGTTCTTGTCGACTGGCTCAAGGGCCTCGTCAGAGAGGTGGACGGTCTTCGCCACGCGCCCAACATC
GCGGGCCCCGTGCAGGAGCTCAAGGAGCTTATTGAAAGCACAGCCGAGCTGCGCATGCTGGCCTCGGCCATGTTT
GACGAAGTGCCAGACAAGGACCCCTACCGCCAGGACCCCATGGGCAACAAGCAGATCCGCAGCTATCACCACATG
CTCCTCATCTTCCAATACGTCATGATGCATGTGGCGCCGAAATGGAGCATGTCGGAGACGGGGGCGGGCTTGATT
GGCTTCCCGTTTAATGCGGTGCTCGACTGGCCCATGGCCACGGCCAGTGGATATGCCTTTTTCCTCAAGAAAGAG
GTGAATTTGAAGCTCAAAAAGATTCTCGACACGTGGCGCGACACCGTCTTGACGACGGAAAAGTCGCTTGTTGTG
TTGAATGAGGGCCAGGATGGCTGGCTGGGGCCGAGACCCTTGGCCAAAATCGAGAGCGACACCAACGTGACGGAC
CACAAGTCGCTCAAGTTCCACGAGCTGTTTGAGTGCAATCCCGACCTGCCGCACTGGGGCTTCAAGAGCTGGGAC
GATTTCTTCATCCGCCGGTTCCGCAACTTTGACAAGATTCGGCCCACCATGTTCAAAGACTGTCCCGAGTGGATT
GTCAACTCGTGCGAGTCCAAGCCCTTTGCGCTGCAGCTCAAGGTCAAGGCGAGAGATTCGTTTTGGCTCAAGGGA
CAGCCGTACTCGGTGAGCGAGATGCTCGACGGGCACGAGCTGGCTGATAGGTTTGTCGGCGGCACTGTCTACCAG
GCGTTTCTCAGCGCGACTTCGTATCATCGTTGGAACTCGCCCGTGTCGGGCAGAGTGGTGCATAGCCAGATTATT
GACGGGACATACTTTTCCGAGCCCACCGTCACTGGCTTCACTTCACCCGATGGACCTGACCCGGCGGCGCCCGAT
CAGGCCCAGGGCTATATTACGCATGTTGCAACGCGGGCTCTCGTTTTCATCGAGGCGGCGCCGCCAGTGGGCCTC
ATGGCGGTGGTCTATGTCGGCATGTCGGACGTCTCTTCGTGTGAGATTTTGCCAAAGTTTGCCGCGTCCAAGCTG
CCGGTCAATGTGTGTAAGGGAGATGAGATTGGCATGTTTCATCATGGGGGCTCGACGCATGCTATGCTCTTTGGA
AAGGATGTTAAGCTTGCCTGGGTTGCCGGCGCCATGCCGGGTGCTTTGAGTCATAATTTGGCTATACGTAGTGAG
CTGGCCATGGTCTACAAGTAG
Gene >OphauG2|2710
ATGTCCCACGTTATTCCCATTATGCCGACTCGGCCTCTGCACCACTTGACCCGTATCGGCGGCTGGTTGCCCGAG
AACCCCAATGTTCTTGTCGACTGGCTCAAGGGCCTCGTCAGAGAGGTGGACGGTCTTCGCCACGCGCCCAACATC
GCGGGCCCCGTGCAGGAGCTCAAGGAGCTTATTGAAAGCACAGCCGAGCTGCGCATGCTGGCCTCGGCCATGTTT
GACGAAGTGCCAGACAAGGACCCCTACCGCCAGGACCCCATGGGCAACAAGCAGATCCGCAGCTATCACCACATG
CTCCTCATCTTCCAATACGTCATGATGCATGTGGCGCCGAAATGGAGCATGTCGGAGACGGGGGCGGGCTTGATT
GGCTTCCCGTTTAATGCGGTGCTCGACTGGCCCATGGCCACGGCCAGTGGATATGCCTTTTTCCTCAAGAAAGAG
GTGAATTTGAAGCTCAAAAAGATTCTCGACACGTGGCGCGACACCGTCTTGACGACGGAAAAGTCGCTTGTTGTG
TTGAATGAGGGCCAGGATGGCTGGCTGGGGCCGAGACCCTTGGCCAAAATCGAGAGCGACACCAACGTGACGGAC
CACAAGTCGCTCAAGTTCCACGAGCTGTTTGAGTGCAATCCCGACCTGCCGCACTGGGGCTTCAAGAGCTGGGAC
GATTTCTTCATCCGCCGGTTCCGCAACTTTGACAAGATTCGGCCCACCATGTTCAAAGACTGTCCCGAGTGGATT
GTCAACTCGTGCGAGTCCAAGCCCTTTGCGCTGCAGCTCAAGGTCAAGGCGAGAGATTCGTTTTGGCTCAAGGGA
CAGCCGTACTCGGTGAGCGAGATGCTCGACGGGCACGAGCTGGCTGATAGGTTTGTCGGCGGCACTGTCTACCAG
GCGTTTCTCAGCGCGACTTCGTATCATCGTTGGAACTCGCCCGTGTCGGGCAGAGTGGTGCATAGCCAGATTATT
GACGGGACATACTTTTCCGAGCCCACCGTCACTGGCTTCACTTCACCCGATGGACCTGACCCGGCGGCGCCCGAT
CAGGCCCAGGGCTATATTACGCATGTTGCAACGCGGGCTCTCGTTTTCATCGAGGCGGCGCCGCCAGTGGGCCTC
ATGGCGGTGGTCTATGTCGGCATGTCGGACGTCTCTTCGTGTGAGATTTTGCCAAAGTTTGCCGCGTCCAAGCTG
CCGGTCAATGTGTGTAAGGGAGATGAGATTGGCATGTTTCATCATGGGGGCTCGACGCATGCTATGCTCTTTGGA
AAGGATGTTAAGCTTGCCTGGGTTGCCGGCGCCATGCCGGGTGCTTTGAGTCATAATTTGGCTATACGTAGTGAG
CTGGCCATGGTCTACAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail