Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2704
Gene name
LocationContig_2004:73..1527
Strand+
Gene length (bp)1454
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16897 MMR_HSR1_Xtn C-terminal region of MMR_HSR1 domain 2.3E-39 173 279
PF01926 MMR_HSR1 50S ribosome-binding GTPase 5.2E-19 56 149
PF02824 TGS TGS domain 5.1E-13 281 331
PF02421 FeoB_N Ferrous iron transport protein B 4.8E-08 56 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39729|RBG1_YEAST Ribosome-interacting GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBG1 PE=1 SV=1 1 340 1.0E-178
sp|Q9UT21|YFY7_SCHPO Uncharacterized GTP-binding protein C9.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9.07c PE=2 SV=1 1 340 1.0E-172
sp|P32234|128UP_DROME GTP-binding protein 128up OS=Drosophila melanogaster GN=128up PE=2 SV=2 1 340 9.0E-161
sp|P43690|DRG1_XENLA Developmentally-regulated GTP-binding protein 1 OS=Xenopus laevis GN=drg1 PE=2 SV=1 1 339 3.0E-157
sp|Q9Y295|DRG1_HUMAN Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens GN=DRG1 PE=1 SV=1 1 339 9.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39729|RBG1_YEAST Ribosome-interacting GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBG1 PE=1 SV=1 1 340 1.0E-178
sp|Q9UT21|YFY7_SCHPO Uncharacterized GTP-binding protein C9.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9.07c PE=2 SV=1 1 340 1.0E-172
sp|P32234|128UP_DROME GTP-binding protein 128up OS=Drosophila melanogaster GN=128up PE=2 SV=2 1 340 9.0E-161
sp|P43690|DRG1_XENLA Developmentally-regulated GTP-binding protein 1 OS=Xenopus laevis GN=drg1 PE=2 SV=1 1 339 3.0E-157
sp|Q9Y295|DRG1_HUMAN Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens GN=DRG1 PE=1 SV=1 1 339 9.0E-157
sp|Q3MHP5|DRG1_BOVIN Developmentally-regulated GTP-binding protein 1 OS=Bos taurus GN=DRG1 PE=2 SV=1 1 339 9.0E-157
sp|P32233|DRG1_MOUSE Developmentally-regulated GTP-binding protein 1 OS=Mus musculus GN=Drg1 PE=1 SV=1 1 339 4.0E-156
sp|Q9SVA6|DRG3_ARATH Developmentally-regulated G-protein 3 OS=Arabidopsis thaliana GN=DRG3 PE=1 SV=1 1 337 3.0E-150
sp|Q54HP3|DRG1_DICDI Developmentally-regulated GTP-binding protein 1 homolog OS=Dictyostelium discoideum GN=drg1 PE=3 SV=1 3 337 4.0E-143
sp|Q9LQK0|DRG1_ARATH Developmentally-regulated G-protein 1 OS=Arabidopsis thaliana GN=DRG1 PE=1 SV=1 5 343 1.0E-131
sp|Q9CAI1|DRG2_ARATH Developmentally-regulated G-protein 2 OS=Arabidopsis thaliana GN=DRG2 PE=2 SV=1 5 343 2.0E-130
sp|Q54WT4|DRG2_DICDI Developmentally-regulated GTP-binding protein 2 homolog OS=Dictyostelium discoideum GN=drg2 PE=3 SV=1 5 344 2.0E-122
sp|P34280|YKK3_CAEEL Uncharacterized GTP-binding protein C02F5.3 OS=Caenorhabditis elegans GN=C02F5.3 PE=3 SV=2 5 340 3.0E-120
sp|P32235|GTP1_SCHPO GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtp1 PE=3 SV=2 5 343 5.0E-118
sp|Q9QXB9|DRG2_MOUSE Developmentally-regulated GTP-binding protein 2 OS=Mus musculus GN=Drg2 PE=1 SV=1 5 340 2.0E-113
sp|P55039|DRG2_HUMAN Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens GN=DRG2 PE=1 SV=1 5 340 1.0E-112
sp|Q58D56|DRG2_BOVIN Developmentally-regulated GTP-binding protein 2 OS=Bos taurus GN=DRG2 PE=2 SV=1 5 340 2.0E-110
sp|P53295|RBG2_YEAST Ribosome-interacting GTPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBG2 PE=1 SV=1 5 340 1.0E-105
sp|Q58722|Y1326_METJA Uncharacterized GTP-binding protein MJ1326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1326 PE=3 SV=1 15 340 5.0E-87
sp|P17103|Y1111_HALSA Uncharacterized GTP-binding protein VNG_1111G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1111G PE=3 SV=1 16 339 3.0E-47
sp|A5IYU8|OBG_MYCAP GTPase Obg OS=Mycoplasma agalactiae (strain PG2) GN=obg PE=3 SV=1 57 176 6.0E-15
sp|A3CM33|OBG_STRSV GTPase Obg OS=Streptococcus sanguinis (strain SK36) GN=obg PE=3 SV=1 56 172 2.0E-14
sp|B3PMC1|OBG_MYCA5 GTPase Obg OS=Mycoplasma arthritidis (strain 158L3-1) GN=obg PE=3 SV=1 56 256 2.0E-14
sp|Q0RPF6|OBG_FRAAA GTPase Obg OS=Frankia alni (strain ACN14a) GN=obg PE=3 SV=1 56 172 2.0E-14
sp|A8MHK8|OBG_ALKOO GTPase Obg OS=Alkaliphilus oremlandii (strain OhILAs) GN=obg PE=3 SV=1 56 224 3.0E-14
sp|A8L1V6|OBG_FRASN GTPase Obg OS=Frankia sp. (strain EAN1pec) GN=obg PE=3 SV=1 56 172 4.0E-14
sp|Q2G983|OBG_NOVAD GTPase Obg OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=obg PE=3 SV=2 56 230 4.0E-14
sp|A8AWM9|OBG_STRGC GTPase Obg OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=obg PE=3 SV=1 56 172 5.0E-14
sp|B8ZPS8|OBG_STRPJ GTPase Obg OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=obg PE=3 SV=1 56 198 5.0E-14
sp|B9KER3|OBG_CAMLR GTPase Obg OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=obg PE=3 SV=1 56 196 5.0E-14
sp|Q24SP0|OBG_DESHY GTPase Obg OS=Desulfitobacterium hafniense (strain Y51) GN=obg PE=3 SV=1 56 172 6.0E-14
sp|A4VUC8|OBG_STRSY GTPase Obg OS=Streptococcus suis (strain 05ZYH33) GN=obg PE=3 SV=1 56 172 6.0E-14
sp|A4W0M2|OBG_STRS2 GTPase Obg OS=Streptococcus suis (strain 98HAH33) GN=obg PE=3 SV=1 56 172 6.0E-14
sp|Q4A6N4|OBG_MYCS5 GTPase Obg OS=Mycoplasma synoviae (strain 53) GN=obg PE=3 SV=1 56 172 6.0E-14
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 56 174 7.0E-14
sp|Q9CF94|OBG_LACLA GTPase Obg OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=obg PE=3 SV=1 56 172 7.0E-14
sp|Q8DPV8|OBG_STRR6 GTPase Obg OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=obg PE=3 SV=1 56 172 8.0E-14
sp|Q04KK7|OBG_STRP2 GTPase Obg OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=obg PE=3 SV=1 56 172 8.0E-14
sp|B2IQ29|OBG_STRPS GTPase Obg OS=Streptococcus pneumoniae (strain CGSP14) GN=obg PE=3 SV=1 56 172 9.0E-14
sp|Q97QW8|OBG_STRPN GTPase Obg OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=obg PE=3 SV=1 56 172 9.0E-14
sp|B5E4J4|OBG_STRP4 GTPase Obg OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=obg PE=3 SV=1 56 172 9.0E-14
sp|Q02XY2|OBG_LACLS GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=obg PE=3 SV=1 56 172 1.0E-13
sp|B1IBL9|OBG_STRPI GTPase Obg OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=obg PE=3 SV=1 56 172 1.0E-13
sp|A2RJQ6|OBG_LACLM GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=obg PE=3 SV=1 56 172 1.0E-13
sp|Q1GSF4|OBG_SPHAL GTPase Obg OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=obg PE=3 SV=1 56 172 1.0E-13
sp|B1XN32|OBG_SYNP2 GTPase Obg OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=obg PE=3 SV=1 18 174 1.0E-13
sp|Q8DUU2|OBG_STRMU GTPase Obg OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=obg PE=3 SV=1 56 172 2.0E-13
sp|Q65GM7|OBG_BACLD GTPase Obg OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=obg PE=3 SV=1 56 172 2.0E-13
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 56 172 2.0E-13
sp|P72931|OBG_SYNY3 GTPase Obg OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=obg PE=3 SV=1 18 172 2.0E-13
sp|Q2JDP2|OBG_FRASC GTPase Obg OS=Frankia sp. (strain CcI3) GN=obg PE=3 SV=1 56 172 3.0E-13
sp|B4U3Q7|OBG_STREM GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=obg PE=3 SV=1 56 172 3.0E-13
sp|Q9WXV3|OBG_THEMA GTPase Obg OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=obg PE=3 SV=1 56 229 3.0E-13
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 57 172 3.0E-13
sp|Q8Y6Z3|OBG_LISMO GTPase Obg OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=obg PE=3 SV=1 56 172 4.0E-13
sp|Q71ZD3|OBG_LISMF GTPase Obg OS=Listeria monocytogenes serotype 4b (strain F2365) GN=obg PE=3 SV=1 56 172 4.0E-13
sp|B8DHL1|OBG_LISMH GTPase Obg OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=obg PE=3 SV=1 56 172 4.0E-13
sp|Q92BH7|OBG_LISIN GTPase Obg OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=obg PE=3 SV=1 56 172 4.0E-13
sp|B7JVH9|OBG_CYAP8 GTPase Obg OS=Cyanothece sp. (strain PCC 8801) GN=obg PE=3 SV=1 18 172 4.0E-13
sp|B8FUR9|OBG_DESHD GTPase Obg OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=obg PE=3 SV=1 56 172 4.0E-13
sp|A0AIY6|OBG_LISW6 GTPase Obg OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=obg PE=3 SV=1 56 172 4.0E-13
sp|Q1IVS5|OBG_KORVE GTPase Obg OS=Koribacter versatilis (strain Ellin345) GN=obg PE=3 SV=1 56 172 5.0E-13
sp|A5IKX2|OBG_THEP1 GTPase Obg OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=obg PE=3 SV=1 56 229 5.0E-13
sp|B1LA53|OBG_THESQ GTPase Obg OS=Thermotoga sp. (strain RQ2) GN=obg PE=3 SV=1 56 172 5.0E-13
sp|Q9KDK0|OBG_BACHD GTPase Obg OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=obg PE=3 SV=1 56 172 5.0E-13
sp|B1YJR9|OBG_EXIS2 GTPase Obg OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=obg PE=3 SV=1 38 172 6.0E-13
sp|Q38WT4|OBG_LACSS GTPase Obg OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=obg PE=3 SV=1 56 172 6.0E-13
sp|A4IRC7|OBG_GEOTN GTPase Obg OS=Geobacillus thermodenitrificans (strain NG80-2) GN=obg PE=3 SV=1 56 172 6.0E-13
sp|Q5KWP5|OBG_GEOKA GTPase Obg OS=Geobacillus kaustophilus (strain HTA426) GN=obg PE=3 SV=1 56 172 7.0E-13
sp|C0MDB4|OBG_STRS7 GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=obg PE=3 SV=1 56 196 7.0E-13
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 56 177 7.0E-13
sp|A9WUU2|OBG_RENSM GTPase Obg OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=obg PE=3 SV=1 56 160 8.0E-13
sp|Q03JJ8|OBG_STRTD GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=obg PE=3 SV=1 56 172 8.0E-13
sp|Q5M3C8|OBG_STRT2 GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=obg PE=3 SV=1 56 172 8.0E-13
sp|Q5LYR4|OBG_STRT1 GTPase Obg OS=Streptococcus thermophilus (strain CNRZ 1066) GN=obg PE=3 SV=1 56 172 8.0E-13
sp|A1R787|OBG_ARTAT GTPase Obg OS=Arthrobacter aurescens (strain TC1) GN=obg PE=3 SV=1 56 160 8.0E-13
sp|Q7MA28|OBG_WOLSU GTPase Obg OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=obg PE=3 SV=1 56 172 8.0E-13
sp|A0JXJ8|OBG_ARTS2 GTPase Obg OS=Arthrobacter sp. (strain FB24) GN=obg PE=3 SV=1 56 160 9.0E-13
sp|A4WZ45|OBG_RHOS5 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=obg PE=3 SV=2 56 172 1.0E-12
sp|A6Q4D2|OBG_NITSB GTPase Obg OS=Nitratiruptor sp. (strain SB155-2) GN=obg PE=3 SV=1 17 172 1.0E-12
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 18 175 1.0E-12
sp|Q8DYL0|OBG_STRA5 GTPase Obg OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q8E465|OBG_STRA3 GTPase Obg OS=Streptococcus agalactiae serotype III (strain NEM316) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q3K046|OBG_STRA1 GTPase Obg OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q82C85|OBG_STRAW GTPase Obg OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|B9KW04|OBG_RHOSK GTPase Obg OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q3IXX9|OBG_RHOS4 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|A3PQJ0|OBG_RHOS1 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|P0DB53|OBG_STRPQ GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|P0DB52|OBG_STRP3 GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 56 196 1.0E-12
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 56 196 1.0E-12
sp|Q2NW34|OBG_SODGM GTPase Obg OS=Sodalis glossinidius (strain morsitans) GN=obg PE=3 SV=1 17 172 1.0E-12
sp|Q1JGD5|OBG_STRPD GTPase Obg OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q48SX8|OBG_STRPM GTPase Obg OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|C0MBS1|OBG_STRE4 GTPase Obg OS=Streptococcus equi subsp. equi (strain 4047) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|B5XLZ0|OBG_STRPZ GTPase Obg OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|C0ZAL7|OBG_BREBN GTPase Obg OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=obg PE=3 SV=1 56 163 1.0E-12
sp|Q8P0I6|OBG_STRP8 GTPase Obg OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q5XBM1|OBG_STRP6 GTPase Obg OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q99Z94|OBG_STRP1 GTPase Obg OS=Streptococcus pyogenes serotype M1 GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q98QK8|OBG_MYCPU GTPase Obg OS=Mycoplasma pulmonis (strain UAB CTIP) GN=obg PE=3 SV=1 17 173 1.0E-12
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 56 214 1.0E-12
sp|Q1JLA1|OBG_STRPC GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q1JBB7|OBG_STRPB GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|Q1J652|OBG_STRPF GTPase Obg OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=obg PE=3 SV=1 56 172 1.0E-12
sp|A2RE30|OBG_STRPG GTPase Obg OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|A7Z781|OBG_BACMF GTPase Obg OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|Q88VG4|OBG_LACPL GTPase Obg OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 17 172 2.0E-12
sp|Q67SC6|OBG_SYMTH GTPase Obg OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|B2KAW2|OBG_ELUMP GTPase Obg OS=Elusimicrobium minutum (strain Pei191) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|B9DSH7|OBG_STRU0 GTPase Obg OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|Q5WHS8|OBG_BACSK GTPase Obg OS=Bacillus clausii (strain KSM-K16) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|B2G6R9|OBG_LACRJ GTPase Obg OS=Lactobacillus reuteri (strain JCM 1112) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|A5VJ99|OBG_LACRD GTPase Obg OS=Lactobacillus reuteri (strain DSM 20016) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|Q6F0U3|OBG_MESFL GTPase Obg OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=obg PE=3 SV=1 18 172 2.0E-12
sp|B8H9P2|OBG_ARTCA GTPase Obg OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=obg PE=3 SV=1 56 186 2.0E-12
sp|A0RR37|OBG_CAMFF GTPase Obg OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=obg PE=3 SV=1 56 202 2.0E-12
sp|Q1DC95|OBG_MYXXD GTPase Obg OS=Myxococcus xanthus (strain DK 1622) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|B7GIR2|OBG_ANOFW GTPase Obg OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=obg PE=3 SV=1 56 172 2.0E-12
sp|P20964|OBG_BACSU GTPase Obg OS=Bacillus subtilis (strain 168) GN=obg PE=1 SV=1 56 172 3.0E-12
sp|B7KIC1|OBG_CYAP7 GTPase Obg OS=Cyanothece sp. (strain PCC 7424) GN=obg PE=3 SV=1 18 201 3.0E-12
sp|B2V0A8|OBG_CLOBA GTPase Obg OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=obg PE=3 SV=1 56 172 3.0E-12
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 56 175 4.0E-12
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 56 214 4.0E-12
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 56 214 4.0E-12
sp|A8FFS8|OBG_BACP2 GTPase Obg OS=Bacillus pumilus (strain SAFR-032) GN=obg PE=3 SV=1 56 172 4.0E-12
sp|A8YV14|OBG_LACH4 GTPase Obg OS=Lactobacillus helveticus (strain DPC 4571) GN=obg PE=3 SV=1 56 175 5.0E-12
sp|Q6MEQ6|OBG_PARUW GTPase Obg OS=Protochlamydia amoebophila (strain UWE25) GN=obg PE=3 SV=1 56 172 5.0E-12
sp|B2TK70|OBG_CLOBB GTPase Obg OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=obg PE=3 SV=1 56 172 6.0E-12
sp|A0LPF9|OBG_SYNFM GTPase Obg OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=obg PE=3 SV=1 56 199 6.0E-12
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 56 172 7.0E-12
sp|Q30QP0|OBG_SULDN GTPase Obg OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=obg PE=3 SV=1 56 285 7.0E-12
sp|A6LQR9|OBG_CLOB8 GTPase Obg OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=obg PE=3 SV=1 56 172 7.0E-12
sp|Q49Y82|OBG_STAS1 GTPase Obg OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=obg PE=3 SV=1 56 196 7.0E-12
sp|B3WE52|OBG_LACCB GTPase Obg OS=Lactobacillus casei (strain BL23) GN=obg PE=3 SV=1 56 172 8.0E-12
sp|Q834V4|OBG_ENTFA GTPase Obg OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=obg PE=3 SV=1 56 172 8.0E-12
sp|Q039J3|OBG_LACC3 GTPase Obg OS=Lactobacillus casei (strain ATCC 334) GN=obg PE=3 SV=1 56 172 8.0E-12
sp|B1KGH1|OBG_SHEWM GTPase Obg OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=obg PE=3 SV=1 33 275 9.0E-12
sp|B5ZBV6|OBG_UREU1 GTPase Obg OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=obg PE=3 SV=1 57 231 9.0E-12
sp|Q03QP2|OBG_LACBA GTPase Obg OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=obg PE=3 SV=1 56 172 1.0E-11
sp|Q89AE7|OBG_BUCBP GTPase Obg OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=obg PE=3 SV=1 57 170 1.0E-11
sp|A7H029|OBG_CAMC5 GTPase Obg OS=Campylobacter curvus (strain 525.92) GN=obg PE=3 SV=1 56 172 1.0E-11
sp|Q1LSJ9|OBG_BAUCH GTPase Obg OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=obg PE=3 SV=1 32 182 1.0E-11
sp|Q043W1|OBG_LACGA GTPase Obg OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=obg PE=3 SV=1 56 155 1.0E-11
sp|Q74JN7|OBG_LACJO GTPase Obg OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=obg PE=3 SV=1 56 155 1.0E-11
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 56 174 1.0E-11
sp|B4UIU2|OBG_ANASK GTPase Obg OS=Anaeromyxobacter sp. (strain K) GN=obg PE=3 SV=1 56 172 1.0E-11
sp|Q2IH84|OBG_ANADE GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=obg PE=3 SV=1 56 172 1.0E-11
sp|B1X0M2|OBG_CYAA5 GTPase Obg OS=Cyanothece sp. (strain ATCC 51142) GN=obg PE=3 SV=1 18 172 2.0E-11
sp|Q28Q12|OBG_JANSC GTPase Obg OS=Jannaschia sp. (strain CCS1) GN=obg PE=3 SV=2 56 224 2.0E-11
sp|B1HVB2|OBG_LYSSC GTPase Obg OS=Lysinibacillus sphaericus (strain C3-41) GN=obg PE=3 SV=2 56 172 2.0E-11
sp|A9AXD9|OBG_HERA2 GTPase Obg OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=obg PE=3 SV=1 56 172 2.0E-11
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 56 172 2.0E-11
sp|A4SCP4|OBG_CHLPM GTPase Obg OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=obg PE=3 SV=1 56 172 2.0E-11
sp|B1M697|OBG_METRJ GTPase Obg OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=obg PE=3 SV=1 56 172 2.0E-11
sp|Q7NB30|OBG_MYCGA GTPase Obg OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=obg PE=3 SV=2 56 150 2.0E-11
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 56 172 2.0E-11
sp|Q022G3|OBG_SOLUE GTPase Obg OS=Solibacter usitatus (strain Ellin6076) GN=obg PE=3 SV=1 56 172 2.0E-11
sp|Q8K9G1|OBG_BUCAP GTPase Obg OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=obg PE=3 SV=1 57 172 3.0E-11
sp|B3DVG9|OBG_METI4 GTPase Obg OS=Methylacidiphilum infernorum (isolate V4) GN=obg PE=3 SV=2 56 172 3.0E-11
sp|Q2NCX8|OBG_ERYLH GTPase Obg OS=Erythrobacter litoralis (strain HTCC2594) GN=obg PE=3 SV=1 56 172 3.0E-11
sp|Q4L6Y9|OBG_STAHJ GTPase Obg OS=Staphylococcus haemolyticus (strain JCSC1435) GN=obg PE=3 SV=1 56 172 3.0E-11
sp|B1H0I4|OBG_UNCTG GTPase Obg OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=obg PE=3 SV=1 56 222 3.0E-11
sp|B8GQQ3|OBG_THISH GTPase Obg OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=obg PE=3 SV=1 56 172 3.0E-11
sp|Q9PQ29|OBG_UREPA GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=obg PE=3 SV=1 57 228 3.0E-11
sp|B1AJA2|OBG_UREP2 GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=obg PE=3 SV=1 57 228 3.0E-11
sp|Q3APF4|OBG_CHLCH GTPase Obg OS=Chlorobium chlorochromatii (strain CaD3) GN=obg PE=3 SV=1 56 172 4.0E-11
sp|B4F2A8|OBG_PROMH GTPase Obg OS=Proteus mirabilis (strain HI4320) GN=obg PE=3 SV=1 56 172 4.0E-11
sp|Q7VK84|OBG_HELHP GTPase Obg OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=obg PE=3 SV=1 56 172 4.0E-11
sp|A9BK05|OBG_PETMO GTPase Obg OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=obg PE=3 SV=1 56 282 4.0E-11
sp|A9VIR5|OBG_BACWK GTPase Obg OS=Bacillus weihenstephanensis (strain KBAB4) GN=obg PE=3 SV=1 56 172 4.0E-11
sp|B8JBP2|OBG_ANAD2 GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=obg PE=3 SV=1 56 172 4.0E-11
sp|A8EV83|OBG_ARCB4 GTPase Obg OS=Arcobacter butzleri (strain RM4018) GN=obg PE=3 SV=1 57 172 4.0E-11
sp|Q12K23|OBG_SHEDO GTPase Obg OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=obg PE=3 SV=1 58 172 4.0E-11
sp|Q0PC41|OBG_CAMJE GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=obg PE=3 SV=1 56 172 4.0E-11
sp|Q5FKH5|OBG_LACAC GTPase Obg OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=obg PE=3 SV=1 56 155 5.0E-11
sp|A1VXH9|OBG_CAMJJ GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=obg PE=3 SV=1 56 172 5.0E-11
sp|Q97JL4|OBG_CLOAB GTPase Obg OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=obg PE=3 SV=1 56 172 5.0E-11
sp|Q3AF51|OBG_CARHZ GTPase Obg OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=obg PE=3 SV=1 56 172 5.0E-11
sp|A8H0U4|OBG_SHEPA GTPase Obg OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=obg PE=3 SV=1 58 172 5.0E-11
sp|P95722|OBG_STRCO GTPase Obg OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=obg PE=1 SV=1 56 172 5.0E-11
sp|A7I166|OBG_CAMHC GTPase Obg OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=obg PE=3 SV=1 57 150 5.0E-11
sp|B8HU67|OBG_CYAP4 GTPase Obg OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=obg PE=3 SV=1 18 172 5.0E-11
sp|B8CSY3|OBG_SHEPW GTPase Obg OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=obg PE=3 SV=1 56 172 6.0E-11
sp|B3QZT1|OBG_PHYMT GTPase Obg OS=Phytoplasma mali (strain AT) GN=obg PE=3 SV=1 56 172 6.0E-11
sp|A9NF57|OBG_ACHLI GTPase Obg OS=Acholeplasma laidlawii (strain PG-8A) GN=obg PE=3 SV=1 18 152 6.0E-11
sp|B2GBD0|OBG_LACF3 GTPase Obg OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=obg PE=3 SV=1 56 172 6.0E-11
sp|B8CXZ0|OBG_HALOH GTPase Obg OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=obg PE=3 SV=1 56 172 6.0E-11
sp|Q8EWL0|OBG_MYCPE GTPase Obg OS=Mycoplasma penetrans (strain HF-2) GN=obg PE=3 SV=1 56 174 6.0E-11
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 56 163 6.0E-11
sp|Q47VL4|OBG_COLP3 GTPase Obg OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=obg PE=3 SV=1 60 172 6.0E-11
sp|A9L430|OBG_SHEB9 GTPase Obg OS=Shewanella baltica (strain OS195) GN=obg PE=3 SV=1 58 172 6.0E-11
sp|A6WK51|OBG_SHEB8 GTPase Obg OS=Shewanella baltica (strain OS185) GN=obg PE=3 SV=1 58 172 6.0E-11
sp|A3D180|OBG_SHEB5 GTPase Obg OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=obg PE=3 SV=1 58 172 6.0E-11
sp|B8EC04|OBG_SHEB2 GTPase Obg OS=Shewanella baltica (strain OS223) GN=obg PE=3 SV=1 58 172 6.0E-11
sp|Q5N4J6|OBG_SYNP6 GTPase Obg OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=obg PE=3 SV=1 18 172 7.0E-11
sp|Q31PN0|OBG_SYNE7 GTPase Obg OS=Synechococcus elongatus (strain PCC 7942) GN=obg PE=3 SV=1 18 172 7.0E-11
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 56 175 7.0E-11
sp|A5VD74|OBG_SPHWW GTPase Obg OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=obg PE=3 SV=1 56 172 7.0E-11
sp|B7IIV2|OBG_BACC2 GTPase Obg OS=Bacillus cereus (strain G9842) GN=obg PE=3 SV=1 56 172 7.0E-11
sp|A8Z6G0|OBG_CAMC1 GTPase Obg OS=Campylobacter concisus (strain 13826) GN=obg PE=3 SV=1 57 137 8.0E-11
sp|Q1B629|OBG_MYCSS GTPase Obg OS=Mycobacterium sp. (strain MCS) GN=obg PE=3 SV=1 18 155 8.0E-11
sp|A1UJ07|OBG_MYCSK GTPase Obg OS=Mycobacterium sp. (strain KMS) GN=obg PE=3 SV=1 18 155 8.0E-11
sp|A3Q2F3|OBG_MYCSJ GTPase Obg OS=Mycobacterium sp. (strain JLS) GN=obg PE=3 SV=1 18 155 8.0E-11
sp|Q6D9C3|OBG_PECAS GTPase Obg OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=obg PE=3 SV=1 56 172 8.0E-11
sp|Q5HX70|OBG_CAMJR GTPase Obg OS=Campylobacter jejuni (strain RM1221) GN=obg PE=3 SV=1 56 172 8.0E-11
sp|A8FJQ1|OBG_CAMJ8 GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=obg PE=3 SV=1 56 172 8.0E-11
sp|B1KZR3|OBG_CLOBM GTPase Obg OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=obg PE=3 SV=1 56 272 9.0E-11
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 56 172 9.0E-11
sp|B2IE44|OBG_BEII9 GTPase Obg OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A9KMF5|OBG_CLOPH GTPase Obg OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|Q1QA43|OBG_PSYCK GTPase Obg OS=Psychrobacter cryohalolentis (strain K5) GN=obg PE=3 SV=1 22 173 1.0E-10
sp|B0TUI2|OBG_SHEHH GTPase Obg OS=Shewanella halifaxensis (strain HAW-EB4) GN=obg PE=3 SV=1 58 172 1.0E-10
sp|Q8EPQ0|OBG_OCEIH GTPase Obg OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A4WEZ6|OBG_ENT38 GTPase Obg OS=Enterobacter sp. (strain 638) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|Q8RHS8|OBG_FUSNN GTPase Obg OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=obg PE=3 SV=1 56 138 1.0E-10
sp|B9IZ16|OBG_BACCQ GTPase Obg OS=Bacillus cereus (strain Q1) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A6QB70|OBG_SULNB GTPase Obg OS=Sulfurovum sp. (strain NBC37-1) GN=obg PE=3 SV=1 56 137 1.0E-10
sp|Q72ZY5|OBG_BACC1 GTPase Obg OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|B2UQ30|OBG_AKKM8 GTPase Obg OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=obg PE=3 SV=2 56 172 1.0E-10
sp|Q5RDW1|MTG2_PONAB Mitochondrial ribosome-associated GTPase 2 OS=Pongo abelii GN=MTG2 PE=2 SV=1 56 172 1.0E-10
sp|B8D7S4|OBG_BUCAT GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=obg PE=3 SV=1 57 202 1.0E-10
sp|P57469|OBG_BUCAI GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=obg PE=3 SV=1 57 202 1.0E-10
sp|B8D9H2|OBG_BUCA5 GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=obg PE=3 SV=1 57 202 1.0E-10
sp|Q6HD85|OBG_BACHK GTPase Obg OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|Q634A3|OBG_BACCZ GTPase Obg OS=Bacillus cereus (strain ZK / E33L) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|C1ETN7|OBG_BACC3 GTPase Obg OS=Bacillus cereus (strain 03BB102) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A0RJ47|OBG_BACAH GTPase Obg OS=Bacillus thuringiensis (strain Al Hakam) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|B7JQ26|OBG_BACC0 GTPase Obg OS=Bacillus cereus (strain AH820) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|Q81LF0|OBG_BACAN GTPase Obg OS=Bacillus anthracis GN=obg PE=3 SV=1 56 172 1.0E-10
sp|B3CQ33|OBG_ORITI GTPase Obg OS=Orientia tsutsugamushi (strain Ikeda) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A5CDM6|OBG_ORITB GTPase Obg OS=Orientia tsutsugamushi (strain Boryong) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|B7HQJ8|OBG_BACC7 GTPase Obg OS=Bacillus cereus (strain AH187) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A1SMB4|OBG_NOCSJ GTPase Obg OS=Nocardioides sp. (strain BAA-499 / JS614) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A8F2Y3|OBG_RICM5 GTPase Obg OS=Rickettsia massiliae (strain Mtu5) GN=obg PE=3 SV=2 56 172 1.0E-10
sp|Q817U6|OBG_BACCR GTPase Obg OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A1S9H3|OBG_SHEAM GTPase Obg OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=obg PE=3 SV=1 58 172 1.0E-10
sp|B7HE73|OBG_BACC4 GTPase Obg OS=Bacillus cereus (strain B4264) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|B1ILY5|OBG_CLOBK GTPase Obg OS=Clostridium botulinum (strain Okra / Type B1) GN=obg PE=3 SV=1 56 272 1.0E-10
sp|B5XSV8|OBG_KLEP3 GTPase Obg OS=Klebsiella pneumoniae (strain 342) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|P47624|OBG_MYCGE GTPase Obg OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=obg PE=3 SV=1 57 132 1.0E-10
sp|Q9H4K7|MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens GN=MTG2 PE=1 SV=1 56 172 1.0E-10
sp|Q72HR4|OBG_THET2 GTPase Obg OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=obg PE=3 SV=1 18 172 1.0E-10
sp|A6TEK2|OBG_KLEP7 GTPase Obg OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|Q5SHE9|OBG_THET8 GTPase Obg OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=obg PE=1 SV=1 37 172 1.0E-10
sp|A5UI23|OBG_HAEIG GTPase Obg OS=Haemophilus influenzae (strain PittGG) GN=obg PE=3 SV=1 57 172 1.0E-10
sp|A5UDJ7|OBG_HAEIE GTPase Obg OS=Haemophilus influenzae (strain PittEE) GN=obg PE=3 SV=1 57 172 1.0E-10
sp|A5I666|OBG_CLOBH GTPase Obg OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A7FXU6|OBG_CLOB1 GTPase Obg OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|A7GHK2|OBG_CLOBL GTPase Obg OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=obg PE=3 SV=1 56 272 1.0E-10
sp|Q892N8|OBG_CLOTE GTPase Obg OS=Clostridium tetani (strain Massachusetts / E88) GN=obg PE=3 SV=1 56 172 1.0E-10
sp|Q1AVU3|OBG_RUBXD GTPase Obg OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=obg PE=3 SV=1 18 172 2.0E-10
sp|C0QUB5|OBG_PERMH GTPase Obg OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=obg PE=3 SV=1 57 172 2.0E-10
sp|Q0SR54|OBG_CLOPS GTPase Obg OS=Clostridium perfringens (strain SM101 / Type A) GN=obg PE=3 SV=1 56 172 2.0E-10
sp|Q8XIJ2|OBG_CLOPE GTPase Obg OS=Clostridium perfringens (strain 13 / Type A) GN=obg PE=3 SV=1 56 172 2.0E-10
sp|Q0TNI5|OBG_CLOP1 GTPase Obg OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=obg PE=3 SV=1 56 172 2.0E-10
sp|Q7MYX6|OBG_PHOLL GTPase Obg OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=obg PE=3 SV=1 56 172 2.0E-10
sp|Q0SH51|OBG_RHOJR GTPase Obg OS=Rhodococcus jostii (strain RHA1) GN=obg PE=3 SV=1 56 155 2.0E-10
sp|A8FRU4|OBG_SHESH GTPase Obg OS=Shewanella sediminis (strain HAW-EB3) GN=obg PE=3 SV=1 33 172 2.0E-10
sp|Q5R039|OBG_IDILO GTPase Obg OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=obg PE=3 SV=1 38 172 2.0E-10
sp|P75215|OBG_MYCPN GTPase Obg OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=obg PE=3 SV=1 57 139 2.0E-10
sp|P95758|OBG_STRGR GTPase Obg OS=Streptomyces griseus GN=obg PE=1 SV=1 56 172 2.0E-10
sp|B1VXD8|OBG_STRGG GTPase Obg OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=obg PE=3 SV=1 56 172 2.0E-10
sp|Q07YJ0|OBG_SHEFN GTPase Obg OS=Shewanella frigidimarina (strain NCIMB 400) GN=obg PE=3 SV=1 58 172 2.0E-10
sp|B8I179|OBG_CLOCE GTPase Obg OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=obg PE=3 SV=1 56 172 2.0E-10
sp|A7H1H0|OBG_CAMJD GTPase Obg OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=obg PE=3 SV=1 56 172 2.0E-10
sp|B1N057|OBG_LEUCK GTPase Obg OS=Leuconostoc citreum (strain KM20) GN=obg PE=3 SV=2 18 172 2.0E-10
sp|Q8EB83|OBG_SHEON GTPase Obg OS=Shewanella oneidensis (strain MR-1) GN=obg PE=3 SV=1 58 172 2.0E-10
sp|Q0HRZ8|OBG_SHESR GTPase Obg OS=Shewanella sp. (strain MR-7) GN=obg PE=3 SV=1 58 172 2.0E-10
sp|Q0HLU0|OBG_SHESM GTPase Obg OS=Shewanella sp. (strain MR-4) GN=obg PE=3 SV=1 58 172 2.0E-10
sp|A0L072|OBG_SHESA GTPase Obg OS=Shewanella sp. (strain ANA-3) GN=obg PE=3 SV=1 58 172 2.0E-10
sp|B0JI21|OBG_MICAN GTPase Obg OS=Microcystis aeruginosa (strain NIES-843) GN=obg PE=3 SV=1 18 172 2.0E-10
sp|Q15PF0|OBG_PSEA6 GTPase Obg OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=obg PE=3 SV=1 38 172 2.0E-10
sp|Q2LR77|OBG_SYNAS GTPase Obg OS=Syntrophus aciditrophicus (strain SB) GN=obg PE=3 SV=2 57 172 2.0E-10
sp|Q3B6H6|OBG_CHLL7 GTPase Obg OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=obg PE=3 SV=1 56 183 2.0E-10
sp|A7MJF1|OBG_CROS8 GTPase Obg OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=obg PE=3 SV=1 56 172 2.0E-10
sp|A1RMV6|OBG_SHESW GTPase Obg OS=Shewanella sp. (strain W3-18-1) GN=obg PE=3 SV=1 58 172 2.0E-10
sp|A4Y427|OBG_SHEPC GTPase Obg OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=obg PE=3 SV=1 58 172 2.0E-10
sp|A8F063|OBG_RICCK GTPase Obg OS=Rickettsia canadensis (strain McKiel) GN=obg PE=3 SV=1 56 155 3.0E-10
sp|B9L605|OBG_NAUPA GTPase Obg OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q5NR23|OBG_ZYMMO GTPase Obg OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 57 155 3.0E-10
sp|Q1GHD0|OBG_RUEST GTPase Obg OS=Ruegeria sp. (strain TM1040) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|A8LK09|OBG_DINSH GTPase Obg OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q03F34|OBG_PEDPA GTPase Obg OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=obg PE=3 SV=1 56 155 3.0E-10
sp|A8GTZ9|OBG_RICRS GTPase Obg OS=Rickettsia rickettsii (strain Sheila Smith) GN=obg PE=3 SV=2 56 172 3.0E-10
sp|B0BVJ1|OBG_RICRO GTPase Obg OS=Rickettsia rickettsii (strain Iowa) GN=obg PE=3 SV=2 56 172 3.0E-10
sp|Q1R6F4|OBG_ECOUT GTPase Obg OS=Escherichia coli (strain UTI89 / UPEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q7VP37|OBG_HAEDU GTPase Obg OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=obg PE=3 SV=1 56 238 3.0E-10
sp|A8AQ74|OBG_CITK8 GTPase Obg OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q8FD82|OBG_ECOL6 GTPase Obg OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q0TCS7|OBG_ECOL5 GTPase Obg OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|A1AG86|OBG_ECOK1 GTPase Obg OS=Escherichia coli O1:K1 / APEC GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B5YS72|OBG_ECO5E GTPase Obg OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q8X9K7|OBG_ECO57 GTPase Obg OS=Escherichia coli O157:H7 GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B7MBV2|OBG_ECO45 GTPase Obg OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B4RZH3|OBG_ALTMD GTPase Obg OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=obg1 PE=3 SV=1 17 172 3.0E-10
sp|P42641|OBG_ECOLI GTPase ObgE/CgtA OS=Escherichia coli (strain K12) GN=obgE PE=1 SV=1 56 172 3.0E-10
sp|B1XHF9|OBG_ECODH GTPase Obg OS=Escherichia coli (strain K12 / DH10B) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q83Q14|OBG_SHIFL GTPase Obg OS=Shigella flexneri GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q0T0A1|OBG_SHIF8 GTPase Obg OS=Shigella flexneri serotype 5b (strain 8401) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q31W60|OBG_SHIBS GTPase Obg OS=Shigella boydii serotype 4 (strain Sb227) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B2U1Z4|OBG_SHIB3 GTPase Obg OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B7LR50|OBG_ESCF3 GTPase Obg OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B1LFT3|OBG_ECOSM GTPase Obg OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B6I1Q6|OBG_ECOSE GTPase Obg OS=Escherichia coli (strain SE11) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B7NDG7|OBG_ECOLU GTPase Obg OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B1IQU0|OBG_ECOLC GTPase Obg OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|A8A4Z8|OBG_ECOHS GTPase Obg OS=Escherichia coli O9:H4 (strain HS) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B7M089|OBG_ECO8A GTPase Obg OS=Escherichia coli O8 (strain IAI1) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B7N0W5|OBG_ECO81 GTPase Obg OS=Escherichia coli O81 (strain ED1a) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B7LHP6|OBG_ECO55 GTPase Obg OS=Escherichia coli (strain 55989 / EAEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B7UJ76|OBG_ECO27 GTPase Obg OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|A7ZS79|OBG_ECO24 GTPase Obg OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 56 159 3.0E-10
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 56 159 3.0E-10
sp|Q3YX58|OBG_SHISS GTPase Obg OS=Shigella sonnei (strain Ss046) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B8E0B2|OBG_DICTD GTPase Obg OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|Q32BF0|OBG_SHIDS GTPase Obg OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=obg PE=3 SV=1 56 172 3.0E-10
sp|B7NKQ0|OBG_ECO7I GTPase Obg OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=obg PE=3 SV=1 56 172 4.0E-10
sp|Q4FRK6|OBG_PSYA2 GTPase Obg OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=obg PE=3 SV=1 22 173 4.0E-10
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 56 172 4.0E-10
sp|Q2NIK0|OBG_AYWBP GTPase Obg OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=obg PE=3 SV=1 18 159 4.0E-10
sp|B2HMG1|OBG_MYCMM GTPase Obg OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=obg PE=3 SV=1 56 155 4.0E-10
sp|B4S5P1|OBG_PROA2 GTPase Obg OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=obg PE=3 SV=1 56 172 4.0E-10
sp|Q5Z041|OBG_NOCFA GTPase Obg OS=Nocardia farcinica (strain IFM 10152) GN=obg PE=3 SV=1 56 155 4.0E-10
sp|A9BDI4|OBG_PROM4 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9211) GN=obg PE=3 SV=1 57 172 5.0E-10
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 56 175 5.0E-10
sp|A7IH06|OBG_XANP2 GTPase Obg OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=obg PE=3 SV=1 56 172 5.0E-10
sp|Q5E871|OBG_VIBF1 GTPase Obg OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=obg PE=3 SV=1 56 172 5.0E-10
sp|B9E021|OBG_CLOK1 GTPase Obg OS=Clostridium kluyveri (strain NBRC 12016) GN=obg PE=3 SV=2 56 172 5.0E-10
sp|B1ZZ37|OBG_OPITP GTPase Obg OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=obg PE=3 SV=1 56 172 5.0E-10
sp|B2VGT5|OBG_ERWT9 GTPase Obg OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=obg PE=3 SV=1 56 172 5.0E-10
sp|P44915|OBG_HAEIN GTPase Obg OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=obg PE=3 SV=1 57 172 6.0E-10
sp|Q47MV6|OBG_THEFY GTPase Obg OS=Thermobifida fusca (strain YX) GN=obg PE=3 SV=1 18 172 6.0E-10
sp|B1I5V8|OBG_DESAP GTPase Obg OS=Desulforudis audaxviator (strain MP104C) GN=obg PE=3 SV=1 56 172 6.0E-10
sp|B0UMS4|OBG_METS4 GTPase Obg OS=Methylobacterium sp. (strain 4-46) GN=obg PE=3 SV=1 56 172 6.0E-10
sp|A7HIF8|OBG_ANADF GTPase Obg OS=Anaeromyxobacter sp. (strain Fw109-5) GN=obg PE=3 SV=1 56 172 6.0E-10
sp|A9FJF8|OBG_SORC5 GTPase Obg OS=Sorangium cellulosum (strain So ce56) GN=obg PE=3 SV=1 56 172 6.0E-10
sp|Q4UJV1|OBG_RICFE GTPase Obg OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=obg PE=3 SV=1 56 172 6.0E-10
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 56 172 7.0E-10
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 56 165 7.0E-10
sp|A5WFV1|OBG_PSYWF GTPase Obg OS=Psychrobacter sp. (strain PRwf-1) GN=obg PE=3 SV=1 22 173 7.0E-10
sp|Q6KHM2|OBG_MYCMO GTPase Obg OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=obg PE=3 SV=1 56 138 7.0E-10
sp|Q2RKZ8|OBG_MOOTA GTPase Obg OS=Moorella thermoacetica (strain ATCC 39073) GN=obg PE=3 SV=1 56 172 7.0E-10
sp|Q5M8V6|GTPBA_XENTR GTP-binding protein 10 OS=Xenopus tropicalis GN=gtpbp10 PE=2 SV=1 56 135 7.0E-10
sp|Q03YT6|OBG_LEUMM GTPase Obg OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=obg PE=3 SV=1 56 196 7.0E-10
sp|B8FM68|OBG_DESAA GTPase Obg OS=Desulfatibacillum alkenivorans (strain AK-01) GN=obg PE=3 SV=1 56 172 8.0E-10
sp|B1JMI3|OBG_YERPY GTPase Obg OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=obg PE=3 SV=1 56 275 8.0E-10
sp|Q66F73|OBG_YERPS GTPase Obg OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=obg PE=3 SV=1 56 275 8.0E-10
sp|A4TRJ6|OBG_YERPP GTPase Obg OS=Yersinia pestis (strain Pestoides F) GN=obg PE=3 SV=1 56 275 8.0E-10
sp|Q1CEK0|OBG_YERPN GTPase Obg OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=obg PE=3 SV=1 56 275 8.0E-10
sp|A9R591|OBG_YERPG GTPase Obg OS=Yersinia pestis bv. Antiqua (strain Angola) GN=obg PE=3 SV=1 56 275 8.0E-10
sp|Q7CKJ6|OBG_YERPE GTPase Obg OS=Yersinia pestis GN=obg PE=3 SV=1 56 275 8.0E-10
sp|B2K2P2|OBG_YERPB GTPase Obg OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=obg PE=3 SV=1 56 275 8.0E-10
sp|Q1CBZ4|OBG_YERPA GTPase Obg OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=obg PE=3 SV=1 56 275 8.0E-10
sp|A7FMT5|OBG_YERP3 GTPase Obg OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=obg PE=3 SV=1 56 275 8.0E-10
sp|Q5PAA7|OBG2_ANAMM GTPase Obg 2 OS=Anaplasma marginale (strain St. Maries) GN=obg2 PE=3 SV=1 57 141 8.0E-10
sp|B9KJ19|OBG2_ANAMF GTPase Obg 2 OS=Anaplasma marginale (strain Florida) GN=obg2 PE=3 SV=1 57 141 8.0E-10
sp|C1A1L5|OBG_RHOE4 GTPase Obg OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=obg PE=3 SV=1 56 155 8.0E-10
sp|B5FGF9|OBG_VIBFM GTPase Obg OS=Vibrio fischeri (strain MJ11) GN=obg PE=3 SV=1 56 172 8.0E-10
sp|A0PU15|OBG_MYCUA GTPase Obg OS=Mycobacterium ulcerans (strain Agy99) GN=obg PE=3 SV=1 56 155 8.0E-10
sp|Q11Z03|OBG_CYTH3 GTPase Obg OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=obg PE=3 SV=1 56 171 8.0E-10
sp|Q92G19|OBG_RICCN GTPase Obg OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=obg PE=3 SV=2 56 172 9.0E-10
sp|Q165Y6|OBG_ROSDO GTPase Obg OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|A1B9C8|OBG_PARDP GTPase Obg OS=Paracoccus denitrificans (strain Pd 1222) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|Q4QM31|OBG_HAEI8 GTPase Obg OS=Haemophilus influenzae (strain 86-028NP) GN=obg PE=3 SV=1 57 172 9.0E-10
sp|B0BRJ9|OBG_ACTPJ GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|B3GZN0|OBG_ACTP7 GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|A4XAG1|OBG_SALTO GTPase Obg OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|A0R149|OBG_MYCS2 GTPase Obg OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=obg PE=3 SV=1 18 155 9.0E-10
sp|Q64XA5|OBG_BACFR GTPase Obg OS=Bacteroides fragilis (strain YCH46) GN=obg PE=3 SV=1 56 155 9.0E-10
sp|Q5LGG9|OBG_BACFN GTPase Obg OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=obg PE=3 SV=2 56 155 9.0E-10
sp|A3QB95|OBG_SHELP GTPase Obg OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|A3MYB2|OBG_ACTP2 GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|A6WDM9|OBG_KINRD GTPase Obg OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=obg PE=3 SV=1 56 172 9.0E-10
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 56 172 1.0E-09
sp|A4T2J4|OBG_MYCGI GTPase Obg OS=Mycobacterium gilvum (strain PYR-GCK) GN=obg PE=3 SV=1 18 155 1.0E-09
sp|Q7VDW9|OBG_PROMA GTPase Obg OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=obg PE=3 SV=1 57 172 1.0E-09
sp|Q5PAS5|OBG1_ANAMM GTPase Obg 1 OS=Anaplasma marginale (strain St. Maries) GN=obg1 PE=3 SV=1 57 141 1.0E-09
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 56 172 1.0E-09
sp|B9KIJ7|OBG1_ANAMF GTPase Obg 1 OS=Anaplasma marginale (strain Florida) GN=obg1 PE=3 SV=1 57 141 1.0E-09
sp|A9VYM4|OBG_METEP GTPase Obg OS=Methylobacterium extorquens (strain PA1) GN=obg PE=3 SV=1 56 172 1.0E-09
sp|B7KSH0|OBG_METC4 GTPase Obg OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=obg PE=3 SV=1 56 172 1.0E-09
sp|B8F871|OBG_HAEPS GTPase Obg OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=obg PE=3 SV=1 56 226 1.0E-09
sp|Q04EZ8|OBG_OENOB GTPase Obg OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=obg PE=3 SV=1 56 202 1.0E-09
sp|A7HT67|OBG_PARL1 GTPase Obg OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=obg PE=3 SV=1 56 172 1.0E-09
sp|B1ZL15|OBG_METPB GTPase Obg OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=obg PE=3 SV=1 56 172 1.0E-09
sp|A5E965|OBG_BRASB GTPase Obg OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=obg PE=3 SV=1 56 156 1.0E-09
sp|A8M0Y9|OBG_SALAI GTPase Obg OS=Salinispora arenicola (strain CNS-205) GN=obg PE=3 SV=1 56 156 1.0E-09
sp|Q3ZAJ2|OBG_DEHM1 GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=obg PE=3 SV=1 57 172 1.0E-09
sp|Q0AHG5|OBG_NITEC GTPase Obg OS=Nitrosomonas eutropha (strain C91) GN=obg PE=3 SV=1 56 172 1.0E-09
sp|A1JIV6|OBG_YERE8 GTPase Obg OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=obg PE=3 SV=1 56 275 1.0E-09
sp|B5RQB8|OBG_BORRA GTPase Obg OS=Borrelia recurrentis (strain A1) GN=obg PE=3 SV=1 56 201 1.0E-09
sp|B9MRB8|OBG_CALBD GTPase Obg OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=obg PE=3 SV=1 56 172 1.0E-09
sp|Q0AWJ4|OBG_SYNWW GTPase Obg OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=obg PE=3 SV=1 21 172 1.0E-09
sp|A4XJS8|OBG_CALS8 GTPase Obg OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=obg PE=3 SV=2 56 172 1.0E-09
sp|A4F9L3|OBG_SACEN GTPase Obg OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=obg PE=3 SV=1 56 152 1.0E-09
sp|A4YKF3|OBG_BRASO GTPase Obg OS=Bradyrhizobium sp. (strain ORS278) GN=obg PE=3 SV=1 56 156 1.0E-09
sp|Q5L6R9|OBG_CHLAB GTPase Obg OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=obg PE=3 SV=1 56 152 1.0E-09
sp|B1VGL9|OBG_CORU7 GTPase Obg OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=obg PE=3 SV=1 56 155 1.0E-09
sp|B0UVI2|OBG_HISS2 GTPase Obg OS=Histophilus somni (strain 2336) GN=obg PE=3 SV=1 56 226 1.0E-09
sp|B2V968|OBG_SULSY GTPase Obg OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=obg PE=3 SV=1 57 172 1.0E-09
sp|Q824F3|OBG_CHLCV GTPase Obg OS=Chlamydophila caviae (strain GPIC) GN=obg PE=3 SV=1 56 152 2.0E-09
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 56 155 2.0E-09
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 56 155 2.0E-09
sp|Q8Z3H1|OBG_SALTI GTPase Obg OS=Salmonella typhi GN=obg PE=3 SV=1 56 172 2.0E-09
sp|A0LCZ3|OBG_MAGMM GTPase Obg OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q8ZLS5|OBG_SALTY GTPase Obg OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=obg PE=1 SV=1 56 172 2.0E-09
sp|B4TWF3|OBG_SALSV GTPase Obg OS=Salmonella schwarzengrund (strain CVM19633) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|B5BGK7|OBG_SALPK GTPase Obg OS=Salmonella paratyphi A (strain AKU_12601) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|C0PZJ5|OBG_SALPC GTPase Obg OS=Salmonella paratyphi C (strain RKS4594) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|A9N750|OBG_SALPB GTPase Obg OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q5PLB7|OBG_SALPA GTPase Obg OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|B4T714|OBG_SALNS GTPase Obg OS=Salmonella newport (strain SL254) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|B4TJ21|OBG_SALHS GTPase Obg OS=Salmonella heidelberg (strain SL476) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|B5R0H4|OBG_SALEP GTPase Obg OS=Salmonella enteritidis PT4 (strain P125109) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|B5FIN3|OBG_SALDC GTPase Obg OS=Salmonella dublin (strain CT_02021853) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q57JG7|OBG_SALCH GTPase Obg OS=Salmonella choleraesuis (strain SC-B67) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|B5F6V2|OBG_SALA4 GTPase Obg OS=Salmonella agona (strain SL483) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|B8EQH4|OBG_METSB GTPase Obg OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|A0M5C6|OBG_GRAFK GTPase Obg OS=Gramella forsetii (strain KT0803) GN=obg PE=3 SV=1 56 135 2.0E-09
sp|A1SSB6|OBG_PSYIN GTPase Obg OS=Psychromonas ingrahamii (strain 37) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q0BZ39|OBG_HYPNA GTPase Obg OS=Hyphomonas neptunium (strain ATCC 15444) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q5ZS70|OBG_LEGPH GTPase Obg OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=obg PE=3 SV=2 56 172 2.0E-09
sp|A5IAS7|OBG_LEGPC GTPase Obg OS=Legionella pneumophila (strain Corby) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q1WT46|OBG_LACS1 GTPase Obg OS=Lactobacillus salivarius (strain UCC118) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q5WTF1|OBG_LEGPL GTPase Obg OS=Legionella pneumophila (strain Lens) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q5X1P1|OBG_LEGPA GTPase Obg OS=Legionella pneumophila (strain Paris) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|A8G8Z4|OBG_SERP5 GTPase Obg OS=Serratia proteamaculans (strain 568) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|A4J7I9|OBG_DESRM GTPase Obg OS=Desulfotomaculum reducens (strain MI-1) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|B5REP9|OBG_SALG2 GTPase Obg OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|A9MP23|OBG_SALAR GTPase Obg OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q8K013|GTPBA_MOUSE GTP-binding protein 10 OS=Mus musculus GN=Gtpbp10 PE=2 SV=1 56 135 2.0E-09
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 56 232 2.0E-09
sp|A1TC21|OBG_MYCVP GTPase Obg OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=obg PE=3 SV=1 18 155 2.0E-09
sp|A5GD29|OBG_GEOUR GTPase Obg OS=Geobacter uraniireducens (strain Rf4) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q9KUS8|OBG_VIBCH GTPase Obg/CgtA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cgtA PE=1 SV=2 32 172 2.0E-09
sp|B6YRA6|OBG_AZOPC GTPase Obg OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=obg PE=3 SV=1 56 162 2.0E-09
sp|B8IEL9|OBG_METNO GTPase Obg OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=obg PE=3 SV=1 56 172 2.0E-09
sp|Q89X89|OBG_BRADU GTPase Obg OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=obg PE=3 SV=1 56 156 2.0E-09
sp|Q253F8|OBG_CHLFF GTPase Obg OS=Chlamydophila felis (strain Fe/C-56) GN=obg PE=3 SV=1 56 152 3.0E-09
sp|B6EL43|OBG_ALISL GTPase Obg OS=Aliivibrio salmonicida (strain LFI1238) GN=obg PE=3 SV=1 56 172 3.0E-09
sp|Q2J3J8|OBG_RHOP2 GTPase Obg OS=Rhodopseudomonas palustris (strain HaA2) GN=obg PE=3 SV=1 56 155 3.0E-09
sp|B3EHE6|OBG_CHLL2 GTPase Obg OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=obg PE=3 SV=1 56 163 3.0E-09
sp|Q73XP5|OBG_MYCPA GTPase Obg OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=obg PE=3 SV=1 56 155 3.0E-09
sp|Q13DL7|OBG_RHOPS GTPase Obg OS=Rhodopseudomonas palustris (strain BisB5) GN=obg PE=3 SV=1 56 155 3.0E-09
sp|A5FMX0|OBG_FLAJ1 GTPase Obg OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=obg PE=3 SV=1 56 135 3.0E-09
sp|A0QDH0|OBG_MYCA1 GTPase Obg OS=Mycobacterium avium (strain 104) GN=obg PE=3 SV=1 56 155 3.0E-09
sp|Q2S3C0|OBG_SALRD GTPase Obg OS=Salinibacter ruber (strain DSM 13855 / M31) GN=obg PE=3 SV=1 56 172 3.0E-09
sp|Q8L7L0|OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana GN=OBGL PE=2 SV=1 57 172 3.0E-09
sp|Q0I1P5|OBG_HAES1 GTPase Obg OS=Haemophilus somnus (strain 129Pt) GN=obg PE=3 SV=1 56 172 3.0E-09
sp|A9IMA6|OBG_BART1 GTPase Obg OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=obg PE=3 SV=1 56 172 3.0E-09
sp|Q04B11|OBG_LACDB GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=obg PE=3 SV=1 56 123 3.0E-09
sp|Q9Z808|OBG_CHLPN GTPase Obg OS=Chlamydia pneumoniae GN=obg PE=3 SV=1 56 172 3.0E-09
sp|Q1GAM3|OBG_LACDA GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=obg PE=3 SV=1 56 123 3.0E-09
sp|Q1RGV9|OBG_RICBR GTPase Obg OS=Rickettsia bellii (strain RML369-C) GN=obg PE=3 SV=1 56 172 3.0E-09
sp|A8GUG0|OBG_RICB8 GTPase Obg OS=Rickettsia bellii (strain OSU 85-389) GN=obg PE=3 SV=1 56 172 3.0E-09
sp|B0CDA2|OBG_ACAM1 GTPase Obg OS=Acaryochloris marina (strain MBIC 11017) GN=obg PE=3 SV=1 18 172 3.0E-09
sp|Q6AK07|OBG_DESPS GTPase Obg OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=obg PE=3 SV=1 23 155 3.0E-09
sp|Q9ZMD3|OBG_HELPJ GTPase Obg OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=obg PE=3 SV=1 56 172 4.0E-09
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 56 135 4.0E-09
sp|A1WY48|OBG_HALHL GTPase Obg OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=obg PE=3 SV=1 56 172 4.0E-09
sp|Q9ZCB6|OBG_RICPR GTPase Obg OS=Rickettsia prowazekii (strain Madrid E) GN=obg PE=3 SV=1 56 172 4.0E-09
sp|A6L100|OBG_BACV8 GTPase Obg OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=obg PE=3 SV=1 56 135 4.0E-09
sp|Q6NDE6|OBG_RHOPA GTPase Obg OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=obg PE=3 SV=1 56 155 4.0E-09
sp|B7VID5|OBG_VIBTL GTPase Obg OS=Vibrio tasmaniensis (strain LGP32) GN=obg PE=3 SV=1 57 172 4.0E-09
sp|A5CR32|OBG_CLAM3 GTPase Obg OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=obg PE=3 SV=1 56 163 4.0E-09
sp|B3Q731|OBG_RHOPT GTPase Obg OS=Rhodopseudomonas palustris (strain TIE-1) GN=obg PE=3 SV=1 56 155 4.0E-09
sp|Q602A7|OBG_MYCH2 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 232) GN=obg PE=3 SV=1 57 159 5.0E-09
sp|Q8G4U0|OBG_BIFLO GTPase Obg OS=Bifidobacterium longum (strain NCC 2705) GN=obg PE=3 SV=1 56 152 5.0E-09
sp|B3EP74|OBG_CHLPB GTPase Obg OS=Chlorobium phaeobacteroides (strain BS1) GN=obg PE=3 SV=1 56 172 5.0E-09
sp|Q07U75|OBG_RHOP5 GTPase Obg OS=Rhodopseudomonas palustris (strain BisA53) GN=obg PE=3 SV=1 56 172 5.0E-09
sp|B7GNK1|OBG_BIFLS GTPase Obg OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=obg PE=3 SV=1 56 152 5.0E-09
sp|Q4AAV4|OBG_MYCHJ GTPase Obg OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=obg PE=3 SV=1 57 159 5.0E-09
sp|Q4A8X1|OBG_MYCH7 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 7448) GN=obg PE=3 SV=1 57 159 5.0E-09
sp|Q6YRC6|OBG_ONYPE GTPase Obg OS=Onion yellows phytoplasma (strain OY-M) GN=obg PE=3 SV=1 18 159 5.0E-09
sp|Q3KLT5|OBG_CHLTA GTPase Obg OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=obg PE=3 SV=1 56 173 5.0E-09
sp|O84423|OBG_CHLTR GTPase Obg OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=obg PE=3 SV=1 56 173 5.0E-09
sp|Q17Y93|OBG_HELAH GTPase Obg OS=Helicobacter acinonychis (strain Sheeba) GN=obg PE=3 SV=1 56 172 6.0E-09
sp|B0RDG3|OBG_CLAMS GTPase Obg OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=obg PE=3 SV=1 56 163 6.0E-09
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 56 172 6.0E-09
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 56 172 6.0E-09
sp|Q5FUL2|OBG_GLUOX GTPase Obg OS=Gluconobacter oxydans (strain 621H) GN=obg PE=3 SV=2 56 172 6.0E-09
sp|Q747Q2|OBG_GEOSL GTPase Obg OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=obg PE=3 SV=1 56 155 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3858
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2704 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2430
Ophiocordyceps camponoti-floridani Ophcf2|04500
Ophiocordyceps camponoti-rufipedis Ophun1|6468
Ophiocordyceps kimflemingae Ophio5|5049
Ophiocordyceps subramaniannii Hirsu2|7636

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2704
MSTTVEKIKEIESEMARTQKNKATSFHLGQLKAKLAKLKRELLMPTSGGGGGGGXFIGFPSVGKSTLMSRLTGQH
SEAAAYEFTTLTSVPGQVIYNGAPLQIIDLPGIIEGAKDGRGRGRQVIAVAKTCHLIFIVLDVNKPLTDKRVIEA
ELEGFGVRINKQPPNITFKKKDKGGLNITSTVPLTHIDHDEIKAVMSEYRINSADITIRCDATVDDVIDVLEARS
RSYIPVVYCLNKIDAISIEELDLLYRIPNAVPISSEHGWNVDELMEMMWDKLSLKRVYTKPKGKQPDYSAPVVLR
ASKCTVEDFCNAIHRSILDQFKTAIVYGKSVKHQPQRTAIIQHAAACLVK*
Coding >OphauG2|2704
ATGTCGACGACTGTGGAAAAGATCAAGGAGATTGAGTCCGAGATGGCTCGGACGCAAAAGAACAAGGCAACGTCG
TTCCACCTGGGCCAACTCAAAGCCAAGCTAGCCAAGCTGAAGCGCGAGCTGCTCATGCCAACGTCGGGGGGTGGC
GGCGGCGGCGGCGNNTTCATAGGCTTCCCGTCAGTGGGCAAGAGCACGCTGATGAGCAGACTAACGGGGCAGCAC
TCGGAAGCGGCAGCGTACGAATTTACAACGCTGACGAGCGTGCCGGGCCAGGTGATTTACAATGGCGCCCCCTTG
CAAATCATTGACCTCCCCGGCATCATCGAGGGCGCCAAGGATGGCCGCGGGCGCGGGCGGCAAGTCATTGCCGTG
GCCAAGACGTGTCACCTCATCTTCATCGTGCTCGATGTCAACAAGCCCCTCACGGACAAGCGCGTCATTGAGGCT
GAGCTGGAAGGCTTTGGCGTGCGCATCAACAAGCAGCCGCCAAACATCACCTTCAAGAAGAAGGACAAGGGCGGG
CTCAACATCACGAGCACTGTCCCCCTGACGCACATTGACCACGACGAAATCAAGGCCGTCATGAGCGAATACCGC
ATCAACTCGGCCGACATTACCATTCGCTGCGACGCCACGGTGGACGATGTCATTGACGTGTTGGAAGCCCGGAGT
CGAAGCTACATCCCCGTCGTCTACTGCCTCAATAAGATTGACGCCATAAGCATTGAGGAGCTGGATCTTTTGTAT
CGCATTCCCAACGCCGTGCCCATCAGCTCCGAGCATGGCTGGAACGTTGACGAGCTCATGGAGATGATGTGGGAC
AAGCTCAGTCTCAAGCGTGTATACACCAAGCCCAAGGGCAAGCAGCCCGACTACTCGGCCCCTGTCGTGCTTCGG
GCCTCCAAGTGCACAGTCGAGGACTTTTGCAATGCCATCCACCGGAGTATTTTGGATCAGTTCAAGACGGCTATA
GTCTACGGCAAATCCGTCAAGCATCAGCCTCAGAGGACTGCCATTATACAGCATGCCGCGGCGTGCCTTGTTAAA
TGA
Transcript >OphauG2|2704
ATGTCGACGACTGTGGAAAAGATCAAGGAGATTGAGTCCGAGATGGCTCGGACGCAAAAGAACAAGGCAACGTCG
TTCCACCTGGGCCAACTCAAAGCCAAGCTAGCCAAGCTGAAGCGCGAGCTGCTCATGCCAACGTCGGGGGGTGGC
GGCGGCGGCGGCGNNTTCATAGGCTTCCCGTCAGTGGGCAAGAGCACGCTGATGAGCAGACTAACGGGGCAGCAC
TCGGAAGCGGCAGCGTACGAATTTACAACGCTGACGAGCGTGCCGGGCCAGGTGATTTACAATGGCGCCCCCTTG
CAAATCATTGACCTCCCCGGCATCATCGAGGGCGCCAAGGATGGCCGCGGGCGCGGGCGGCAAGTCATTGCCGTG
GCCAAGACGTGTCACCTCATCTTCATCGTGCTCGATGTCAACAAGCCCCTCACGGACAAGCGCGTCATTGAGGCT
GAGCTGGAAGGCTTTGGCGTGCGCATCAACAAGCAGCCGCCAAACATCACCTTCAAGAAGAAGGACAAGGGCGGG
CTCAACATCACGAGCACTGTCCCCCTGACGCACATTGACCACGACGAAATCAAGGCCGTCATGAGCGAATACCGC
ATCAACTCGGCCGACATTACCATTCGCTGCGACGCCACGGTGGACGATGTCATTGACGTGTTGGAAGCCCGGAGT
CGAAGCTACATCCCCGTCGTCTACTGCCTCAATAAGATTGACGCCATAAGCATTGAGGAGCTGGATCTTTTGTAT
CGCATTCCCAACGCCGTGCCCATCAGCTCCGAGCATGGCTGGAACGTTGACGAGCTCATGGAGATGATGTGGGAC
AAGCTCAGTCTCAAGCGTGTATACACCAAGCCCAAGGGCAAGCAGCCCGACTACTCGGCCCCTGTCGTGCTTCGG
GCCTCCAAGTGCACAGTCGAGGACTTTTGCAATGCCATCCACCGGAGTATTTTGGATCAGTTCAAGACGGCTATA
GTCTACGGCAAATCCGTCAAGCATCAGCCTCAGAGGACTGCCATTATACAGCATGCCGCGGCGTGCCTTGTTAAA
TGA
Gene >OphauG2|2704
ATGTCGACGACTGTGGAAAAGGTGCGTCAGAGGCTCACAACAGCAAAGATTGAGTCGGACACTAACCAAGCGCTA
TGGAGTAACTAGATCAAGGAGATTGAGTCCGAGGTGTGCTCAAGACCTACGTGGTAGCGGCGAGGGCAGAGTGCT
AATTAAAAAGACAGATGGCTCGGACGCAAAAGAACAAGGCAACGTCGTTCCACCTGGGCCAACTCAAAGCCAAGC
TAGCCAAGCTGAAGCGCGAGCTGCTCATGCCAACGTCGGGGGGTGGCGGCGGCGGCGGCGNNTTCATAGGCTTCC
CGTCAGTGGGCAAGAGCACGCTGATGAGCAGACTAACGGGGCAGCACTCGGAAGCGGCAGCGTACGAATTTACAA
CGCTGACGAGCGTGCCGGGCCAGGTGATTTACAATGGTGAGGGTCTCTCTGGGCATGGCAGGCTCTAGTTGGCGA
TTGGCAGGCTTACGCTCCTGTTCCAGGCGCCCCCTTGCAAATCATTGACCTCCCCGGCATCATCGAGGGCGCCAA
GGATGGCCGCGGGCGCGGGCGGCAAGTCATTGCCGTGGCCAAGACGTGTCACCTCATCTTCATCGTGCTCGATGT
CAACAAGCCCCTCACGGACAAGCGCGTCATTGAGGCTGAGCTGGAAGGCTTTGGCGTGCGCATCAACAAGCAGCC
GCCAAACATCACCTTCAAGAAGAAGGACAAGGGCGGGCTCAACATCACGAGCACTGTCCCCCTGACGCACATTGA
CCACGACGAAATCAAGGCCGTCATGAGCGAATACCGCATCAACTCGGCCGACATTACCATTCGCTGCGACGCCAC
GGTGGACGATGTCATTGACGTGTTGGAAGCCCGGAGTCGAAGGTGAGTGGCCGCCACCGAAAAGGGCCGAGTGGG
CGAGACGCGGCATGTCACTGACGCGAGCCCATTGCTTGCTAGCTACATCCCCGTCGTCTACTGCCTCAATAAGAT
TGACGCCATAAGCATTGAGGAGCTGGATCTTTTGTATCGCATTCCCAACGCCGTGCCCATCAGCTCCGAGCATGG
CTGGAACGTTGACGAGCTCATGGAGATGATGTGGGACAAGCTCAGTCTCAAGCGTGTATACACCAAGCCCAAGGG
CAAGCAGCCCGACTACTCGGCCCCTGTCGTGCTTCGGGCCTCCAAGTGCACAGTCGAGGACTTTGTGAGCGGCCC
CCCTGCTCCCAATATTCCCGGGATGTTGCGCGGCTGACGTGCCCATGTGTCCCGCCTTTGCAGTGCAATGCCATC
CACCGGAGTATTTTGGATCAGTTCAAGACGGCTATAGTCTACGGCAAATCCGTCAAGCATCAGCCTCAGAGGGTT
GGCCTTGCGCATGAGTTGGAGGATGAGGATGTTGGTGAGTGCCGACGTGCGCTCGTGTGCAGACTGCCATTATAC
AGCATGCCGCGGCGTGCCTTGTTAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail