Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2702
Gene name
LocationContig_200:22577..23123
Strand+
Gene length (bp)546
Transcript length (bp)342
Coding sequence length (bp)342
Protein length (aa) 114

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09138 Urm1 Urm1 (Ubiquitin related modifier) 1.8E-32 15 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7ETU4|URM1_SCLS1 Ubiquitin-related modifier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=urm1 PE=3 SV=1 8 113 1.0E-44
sp|Q1E493|URM1_COCIM Ubiquitin-related modifier 1 OS=Coccidioides immitis (strain RS) GN=URM1 PE=3 SV=1 6 113 2.0E-44
sp|Q2U9H6|URM1_ASPOR Ubiquitin-related modifier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=urm1 PE=3 SV=1 12 113 3.0E-43
sp|B2WIC3|URM1_PYRTR Ubiquitin-related modifier 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=urm1 PE=3 SV=1 13 113 8.0E-43
sp|A6S5X1|URM1_BOTFB Ubiquitin-related modifier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=urm1 PE=3 SV=1 8 113 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7ETU4|URM1_SCLS1 Ubiquitin-related modifier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=urm1 PE=3 SV=1 8 113 1.0E-44
sp|Q1E493|URM1_COCIM Ubiquitin-related modifier 1 OS=Coccidioides immitis (strain RS) GN=URM1 PE=3 SV=1 6 113 2.0E-44
sp|Q2U9H6|URM1_ASPOR Ubiquitin-related modifier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=urm1 PE=3 SV=1 12 113 3.0E-43
sp|B2WIC3|URM1_PYRTR Ubiquitin-related modifier 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=urm1 PE=3 SV=1 13 113 8.0E-43
sp|A6S5X1|URM1_BOTFB Ubiquitin-related modifier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=urm1 PE=3 SV=1 8 113 1.0E-42
sp|Q9C245|URM1_NEUCR Ubiquitin-related modifier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=urm1 PE=3 SV=3 11 113 3.0E-42
sp|A6R989|URM1_AJECN Ubiquitin-related modifier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=URM1 PE=3 SV=1 14 113 4.0E-41
sp|A8P008|URM1_COPC7 Ubiquitin-related modifier 1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=URM1 PE=3 SV=1 6 113 7.0E-31
sp|P0CT26|URM1_USTMA Ubiquitin-related modifier 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URM1 PE=3 SV=1 8 113 7.0E-28
sp|A7TQ77|URM1_VANPO Ubiquitin-related modifier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=URM1 PE=3 SV=1 13 113 2.0E-27
sp|B5FVI0|URM1_YARLI Ubiquitin-related modifier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=URM1 PE=3 SV=1 13 113 1.0E-26
sp|A9YUB5|URM1_CAPHI Ubiquitin-related modifier 1 OS=Capra hircus GN=URM1 PE=3 SV=1 10 113 4.0E-26
sp|Q148F0|URM1_BOVIN Ubiquitin-related modifier 1 OS=Bos taurus GN=URM1 PE=3 SV=1 10 113 4.0E-26
sp|Q9BTM9|URM1_HUMAN Ubiquitin-related modifier 1 OS=Homo sapiens GN=URM1 PE=1 SV=1 10 113 5.0E-26
sp|Q5ZJU4|URM1_CHICK Ubiquitin-related modifier 1 OS=Gallus gallus GN=URM1 PE=3 SV=1 10 113 8.0E-26
sp|Q9D2P4|URM1_MOUSE Ubiquitin-related modifier 1 OS=Mus musculus GN=Urm1 PE=1 SV=1 10 113 4.0E-25
sp|B0D4J6|URM1_LACBS Ubiquitin-related modifier 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=URM1 PE=3 SV=1 10 113 7.0E-25
sp|Q54QN0|URM1_DICDI Ubiquitin-related modifier 1 homolog OS=Dictyostelium discoideum GN=urm1 PE=3 SV=1 13 113 9.0E-23
sp|Q59JW3|URM12_CANAL Ubiquitin-related modifier 1-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URM1-2 PE=3 SV=1 13 113 2.0E-22
sp|P40554|URM1_YEAST Ubiquitin-related modifier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URM1 PE=1 SV=1 13 113 4.0E-22
sp|A6ZVR0|URM1_YEAS7 Ubiquitin-related modifier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=URM1 PE=3 SV=1 13 113 4.0E-22
sp|B3LTL7|URM1_YEAS1 Ubiquitin-related modifier 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=URM1 PE=3 SV=1 13 113 4.0E-22
sp|Q1HQ10|URM1_BOMMO Ubiquitin-related modifier 1 homolog OS=Bombyx mori PE=3 SV=1 10 113 6.0E-22
sp|A8IC48|URM1_CHLRE Ubiquitin-related modifier 1 homolog OS=Chlamydomonas reinhardtii GN=URM1 PE=3 SV=1 13 113 9.0E-22
sp|B4HVA2|URM1_DROSE Ubiquitin-related modifier 1 homolog OS=Drosophila sechellia GN=GM13742 PE=3 SV=1 12 113 1.0E-21
sp|Q59WK2|URM11_CANAL Ubiquitin-related modifier 1-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URM1-1 PE=3 SV=1 13 113 2.0E-21
sp|B4QKW3|URM1_DROSI Ubiquitin-related modifier 1 homolog OS=Drosophila simulans GN=GD13043 PE=3 SV=1 12 113 4.0E-21
sp|Q9P3U9|URM1_SCHPO Ubiquitin-related modifier 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urm1 PE=3 SV=2 13 113 6.0E-21
sp|Q6FWQ3|URM1_CANGA Ubiquitin-related modifier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URM1 PE=3 SV=1 17 113 9.0E-21
sp|A3GFM6|URM1_PICST Ubiquitin-related modifier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=URM1 PE=3 SV=1 15 113 1.0E-20
sp|A5DTV4|URM1_LODEL Ubiquitin-related modifier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=URM1 PE=3 SV=1 13 113 1.0E-20
sp|Q7KU86|URM1_DROME Ubiquitin-related modifier 1 homolog OS=Drosophila melanogaster GN=CG33276 PE=3 SV=2 12 113 1.0E-20
sp|B4PCA1|URM1_DROYA Ubiquitin-related modifier 1 homolog OS=Drosophila yakuba GN=GE20399 PE=3 SV=1 12 113 2.0E-20
sp|B3NFA2|URM1_DROER Ubiquitin-related modifier 1 homolog OS=Drosophila erecta GN=GG14947 PE=3 SV=2 12 113 2.0E-20
sp|B3M611|URM1_DROAN Ubiquitin-related modifier 1 homolog OS=Drosophila ananassae GN=GF23776 PE=3 SV=1 12 113 2.0E-20
sp|Q75AD1|URM1_ASHGO Ubiquitin-related modifier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URM1 PE=3 SV=1 17 113 3.0E-20
sp|B4LE67|URM1_DROVI Ubiquitin-related modifier 1 homolog OS=Drosophila virilis GN=GJ12350 PE=3 SV=1 13 113 1.0E-19
sp|Q16Y28|URM1_AEDAE Ubiquitin-related modifier 1 homolog OS=Aedes aegypti GN=AAEL008680 PE=3 SV=1 3 113 2.0E-19
sp|Q6BVZ7|URM1_DEBHA Ubiquitin-related modifier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URM1 PE=3 SV=3 13 113 2.0E-19
sp|Q7Q6I6|URM1_ANOGA Ubiquitin-related modifier 1 homolog OS=Anopheles gambiae GN=AGAP005823 PE=3 SV=4 6 113 6.0E-19
sp|B0W3S2|URM1_CULQU Ubiquitin-related modifier 1 homolog OS=Culex quinquefasciatus GN=CPIJ002088 PE=3 SV=1 3 113 8.0E-19
sp|Q6CQU4|URM1_KLULA Ubiquitin-related modifier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URM1 PE=3 SV=1 17 113 1.0E-18
sp|B5DQK2|URM1_DROPS Ubiquitin-related modifier 1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA23607 PE=3 SV=1 13 113 3.0E-18
sp|B4GUT1|URM1_DROPE Ubiquitin-related modifier 1 homolog OS=Drosophila persimilis GN=GL24132 PE=3 SV=1 13 113 3.0E-18
sp|B6SXH2|URM1_MAIZE Ubiquitin-related modifier 1 homolog OS=Zea mays GN=URM1 PE=3 SV=1 15 113 2.0E-16
sp|B4MLV0|URM1_DROWI Ubiquitin-related modifier 1 homolog OS=Drosophila willistoni GN=GK16796 PE=3 SV=1 10 113 2.0E-16
sp|A0MDQ1|URM11_ARATH Ubiquitin-related modifier 1 homolog 1 OS=Arabidopsis thaliana GN=URM1-1 PE=3 SV=2 12 113 4.0E-16
sp|Q0D6M1|URM1_ORYSJ Ubiquitin-related modifier 1 homolog OS=Oryza sativa subsp. japonica GN=URM1 PE=3 SV=1 15 113 2.0E-15
sp|Q7GBC8|URM1_ORYSI Ubiquitin-related modifier 1 homolog OS=Oryza sativa subsp. indica GN=URM1 PE=3 SV=1 15 113 2.0E-15
sp|B3H7G2|URM12_ARATH Ubiquitin-related modifier 1 homolog 2 OS=Arabidopsis thaliana GN=URM1-2 PE=3 SV=1 12 113 2.0E-15
sp|B4J272|URM1_DROGR Ubiquitin-related modifier 1 homolog OS=Drosophila grimshawi GN=GH16604 PE=3 SV=1 13 113 2.0E-15
sp|B4KYT0|URM1_DROMO Ubiquitin-related modifier 1 homolog OS=Drosophila mojavensis GN=GI12450 PE=3 SV=1 6 113 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0034227 tRNA thio-modification Yes
GO:0005737 cytoplasm Yes
GO:0046483 heterocycle metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006399 tRNA metabolic process No
GO:0006400 tRNA modification No
GO:0043412 macromolecule modification No
GO:0009451 RNA modification No
GO:0006396 RNA processing No
GO:0034660 ncRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0008033 tRNA processing No
GO:0009987 cellular process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6379
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2702 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3525
Ophiocordyceps camponoti-floridani Ophcf2|00624
Ophiocordyceps camponoti-rufipedis Ophun1|7285
Ophiocordyceps kimflemingae Ophio5|7052

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2702
MATSQENLTAKQLTLDVEFSGGLEMLFDHQRYHSLTLPAQDKDGQPSSIAFLIHHLCQHVMRDGRQELFVLDGHI
RPGILVLINDADWELEGEEAYQLNPGDKILFVSTLHGG*
Coding >OphauG2|2702
ATGGCCACGTCTCAGGAAAATCTCACCGCCAAACAGCTCACTCTTGACGTAGAATTCTCCGGAGGACTGGAAATG
CTCTTTGACCATCAACGCTACCACTCGCTGACCCTGCCCGCCCAAGACAAGGACGGCCAGCCAAGCTCGATTGCC
TTTCTGATACATCACCTCTGTCAGCATGTCATGAGAGACGGGCGCCAAGAGCTCTTTGTTCTCGACGGCCACATA
CGCCCTGGCATCCTGGTCCTCATCAACGACGCTGACTGGGAGCTAGAGGGCGAGGAGGCCTACCAGTTAAACCCC
GGGGACAAGATCCTTTTTGTCTCGACTTTGCATGGAGGCTAA
Transcript >OphauG2|2702
ATGGCCACGTCTCAGGAAAATCTCACCGCCAAACAGCTCACTCTTGACGTAGAATTCTCCGGAGGACTGGAAATG
CTCTTTGACCATCAACGCTACCACTCGCTGACCCTGCCCGCCCAAGACAAGGACGGCCAGCCAAGCTCGATTGCC
TTTCTGATACATCACCTCTGTCAGCATGTCATGAGAGACGGGCGCCAAGAGCTCTTTGTTCTCGACGGCCACATA
CGCCCTGGCATCCTGGTCCTCATCAACGACGCTGACTGGGAGCTAGAGGGCGAGGAGGCCTACCAGTTAAACCCC
GGGGACAAGATCCTTTTTGTCTCGACTTTGCATGGAGGCTAA
Gene >OphauG2|2702
ATGGCCACGTCTCAGGAAAATCTCACCGCCAAACAGCTCACTCTTGACGTAGAATTCTCGTAAGTCTCTTCTGCA
CCAGTAAAACACGACCAAGCAACGCCACGCCCTCTCTCTCTCTCTCTCTCTCTCTCATTAGCCTGACCCATACAC
TAACCAGTCCACCAACACATGGCTCCCAGCGGAGGACTGGAAATGCTCTTTGACCATCAACGCTACCACTCGCTG
ACCCTGCCCGCCCAAGACAAGGACGGCCAGCCAAGCTCGATTGCCTTTCTGATACATCACCTCTGTCAGCATGTC
ATGAGAGACGGGCGCCAAGAGCTCTTTGTTCTCGACGGCCACATGTGCGTCGTCCGCGGCCGCTCAACTTGTCCC
CCAAGCACACTTACTGGCTGCTAACCGAGACCACTTCGGCCTCTCCCTTCCAGACGCCCTGGCATCCTGGTCCTC
ATCAACGACGCTGACTGGGAGCTAGAGGGCGAGGAGGCCTACCAGTTAAACCCCGGGGACAAGATCCTTTTTGTC
TCGACTTTGCATGGAGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail