Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2697
Gene name
LocationContig_200:13437..14295
Strand-
Gene length (bp)858
Transcript length (bp)858
Coding sequence length (bp)858
Protein length (aa) 286

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08609 Fes1 Nucleotide exchange factor Fes1 1.8E-29 73 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I624|FES1_GIBZE Hsp70 nucleotide exchange factor FES1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FES1 PE=3 SV=1 68 281 2.0E-97
sp|Q9C239|FES1_NEUCR Hsp70 nucleotide exchange factor fes-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-1 PE=3 SV=1 70 285 2.0E-72
sp|Q0CH70|FES1_ASPTN Hsp70 nucleotide exchange factor fes1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fes1 PE=3 SV=1 70 279 6.0E-71
sp|Q5AYT7|FES1_EMENI Hsp70 nucleotide exchange factor fes1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fes1 PE=3 SV=1 70 279 2.0E-70
sp|Q4WDH3|FES1_ASPFU Hsp70 nucleotide exchange factor fes1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fes1 PE=3 SV=1 70 279 1.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I624|FES1_GIBZE Hsp70 nucleotide exchange factor FES1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FES1 PE=3 SV=1 68 281 2.0E-97
sp|Q9C239|FES1_NEUCR Hsp70 nucleotide exchange factor fes-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-1 PE=3 SV=1 70 285 2.0E-72
sp|Q0CH70|FES1_ASPTN Hsp70 nucleotide exchange factor fes1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fes1 PE=3 SV=1 70 279 6.0E-71
sp|Q5AYT7|FES1_EMENI Hsp70 nucleotide exchange factor fes1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fes1 PE=3 SV=1 70 279 2.0E-70
sp|Q4WDH3|FES1_ASPFU Hsp70 nucleotide exchange factor fes1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fes1 PE=3 SV=1 70 279 1.0E-69
sp|Q2U9E2|FES1_ASPOR Hsp70 nucleotide exchange factor fes1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fes1 PE=3 SV=1 70 279 2.0E-68
sp|Q2GXZ7|FES1_CHAGB Hsp70 nucleotide exchange factor FES1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FES1 PE=3 SV=1 70 283 4.0E-65
sp|A2R4I6|FES1_ASPNC Hsp70 nucleotide exchange factor fes1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fes1 PE=3 SV=1 70 279 3.0E-63
sp|A1DLW4|FES1_NEOFI Hsp70 nucleotide exchange factor fes1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fes1 PE=3 SV=1 70 256 2.0E-62
sp|Q1E3S4|FES1_COCIM Hsp70 nucleotide exchange factor FES1 OS=Coccidioides immitis (strain RS) GN=FES1 PE=3 SV=2 70 280 8.0E-57
sp|Q0V4C4|FES1_PHANO Hsp70 nucleotide exchange factor FES1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FES1 PE=3 SV=1 68 280 4.0E-52
sp|Q6FM01|FES1_CANGA Hsp70 nucleotide exchange factor FES1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FES1 PE=3 SV=1 76 245 3.0E-35
sp|P38260|FES1_YEAST Hsp70 nucleotide exchange factor FES1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FES1 PE=1 SV=1 76 243 3.0E-32
sp|A3LUY1|FES1_PICST Hsp70 nucleotide exchange factor FES1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FES1 PE=3 SV=1 73 245 6.0E-32
sp|Q6C239|FES1_YARLI Hsp70 nucleotide exchange factor FES1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FES1 PE=3 SV=1 73 241 6.0E-31
sp|Q75B89|FES1_ASHGO Hsp70 nucleotide exchange factor FES1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FES1 PE=3 SV=1 73 245 9.0E-31
sp|Q6CNM7|FES1_KLULA Hsp70 nucleotide exchange factor FES1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FES1 PE=3 SV=1 76 241 2.0E-28
sp|Q59NN8|FES1_CANAL Hsp70 nucleotide exchange factor FES1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FES1 PE=3 SV=1 76 246 8.0E-27
sp|Q6BLA1|FES1_DEBHA Hsp70 nucleotide exchange factor FES1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FES1 PE=3 SV=2 73 243 1.0E-26
sp|O43030|FES1_SCHPO Hsp70 nucleotide exchange factor fes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fes1 PE=1 SV=1 92 240 3.0E-26
sp|Q4P7F2|FES1_USTMA Hsp70 nucleotide exchange factor FES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FES1 PE=3 SV=2 70 246 7.0E-23
sp|P0CN68|FES1_CRYNJ Hsp70 nucleotide exchange factor FES1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FES1 PE=3 SV=1 73 242 5.0E-16
sp|P0CN69|FES1_CRYNB Hsp70 nucleotide exchange factor FES1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FES1 PE=3 SV=1 73 242 5.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2697
MDVTQLEPTCSVHLILPETQINKRFNTCFSVETDKNHRQRLSRPNTNQSSRASPNPKRHRDNVTNSVMEDKRLND
LLRWSIENSDATRNDAASGQASSTNPSTNLTPEVMSALMGGPSDADLMKASMDIISAPLGDGVSLSDKLVAFDNF
EQLIENLDNANNMSNLGLWSPLLHQLHSDEADLRKMAAWCIGTAVQNNQQTQERLLAVGGLPTLVAMALDTQNKE
DVRRKAVYALSSACRNYQPAMDVCSEELTKAGHLTNAIDAADMEAVDKVMNALREKAQAA*
Coding >OphauG2|2697
ATGGACGTGACCCAACTCGAGCCTACATGCTCTGTACATCTGATTCTCCCAGAGACACAAATCAACAAGCGATTC
AACACTTGTTTCTCCGTCGAGACAGATAAAAACCACCGACAGCGACTGAGCCGACCCAATACCAACCAGAGTTCA
AGAGCCAGTCCCAACCCAAAGCGCCATCGGGACAACGTCACAAATTCCGTCATGGAGGACAAACGGCTCAACGAT
CTTCTCCGATGGAGCATCGAAAATTCGGACGCGACGCGCAACGATGCTGCGTCAGGCCAAGCTTCCAGCACAAAT
CCAAGCACAAATCTCACACCCGAAGTCATGTCGGCTCTCATGGGCGGGCCGTCAGACGCCGATCTAATGAAGGCC
TCAATGGACATCATTTCGGCCCCTCTCGGCGATGGCGTCAGTCTCAGCGACAAGCTCGTTGCCTTTGACAACTTT
GAGCAGCTCATTGAAAATCTTGACAATGCCAACAACATGAGCAACCTCGGACTCTGGTCTCCACTGCTCCACCAG
CTGCATAGCGACGAAGCAGACTTGCGCAAAATGGCTGCTTGGTGCATTGGAACGGCCGTTCAGAACAACCAGCAG
ACCCAGGAACGCCTCCTCGCTGTCGGTGGCTTGCCCACCCTCGTTGCAATGGCCCTCGACACACAAAACAAGGAG
GATGTAAGGAGAAAGGCTGTCTATGCTCTCAGCTCTGCCTGCAGGAATTACCAACCTGCCATGGATGTCTGTTCT
GAGGAACTTACAAAAGCTGGTCATCTCACCAACGCCATCGACGCTGCCGATATGGAGGCTGTGGACAAGGTTATG
AACGCTTTGAGAGAAAAGGCACAAGCTGCTTAA
Transcript >OphauG2|2697
ATGGACGTGACCCAACTCGAGCCTACATGCTCTGTACATCTGATTCTCCCAGAGACACAAATCAACAAGCGATTC
AACACTTGTTTCTCCGTCGAGACAGATAAAAACCACCGACAGCGACTGAGCCGACCCAATACCAACCAGAGTTCA
AGAGCCAGTCCCAACCCAAAGCGCCATCGGGACAACGTCACAAATTCCGTCATGGAGGACAAACGGCTCAACGAT
CTTCTCCGATGGAGCATCGAAAATTCGGACGCGACGCGCAACGATGCTGCGTCAGGCCAAGCTTCCAGCACAAAT
CCAAGCACAAATCTCACACCCGAAGTCATGTCGGCTCTCATGGGCGGGCCGTCAGACGCCGATCTAATGAAGGCC
TCAATGGACATCATTTCGGCCCCTCTCGGCGATGGCGTCAGTCTCAGCGACAAGCTCGTTGCCTTTGACAACTTT
GAGCAGCTCATTGAAAATCTTGACAATGCCAACAACATGAGCAACCTCGGACTCTGGTCTCCACTGCTCCACCAG
CTGCATAGCGACGAAGCAGACTTGCGCAAAATGGCTGCTTGGTGCATTGGAACGGCCGTTCAGAACAACCAGCAG
ACCCAGGAACGCCTCCTCGCTGTCGGTGGCTTGCCCACCCTCGTTGCAATGGCCCTCGACACACAAAACAAGGAG
GATGTAAGGAGAAAGGCTGTCTATGCTCTCAGCTCTGCCTGCAGGAATTACCAACCTGCCATGGATGTCTGTTCT
GAGGAACTTACAAAAGCTGGTCATCTCACCAACGCCATCGACGCTGCCGATATGGAGGCTGTGGACAAGGTTATG
AACGCTTTGAGAGAAAAGGCACAAGCTGCTTAA
Gene >OphauG2|2697
ATGGACGTGACCCAACTCGAGCCTACATGCTCTGTACATCTGATTCTCCCAGAGACACAAATCAACAAGCGATTC
AACACTTGTTTCTCCGTCGAGACAGATAAAAACCACCGACAGCGACTGAGCCGACCCAATACCAACCAGAGTTCA
AGAGCCAGTCCCAACCCAAAGCGCCATCGGGACAACGTCACAAATTCCGTCATGGAGGACAAACGGCTCAACGAT
CTTCTCCGATGGAGCATCGAAAATTCGGACGCGACGCGCAACGATGCTGCGTCAGGCCAAGCTTCCAGCACAAAT
CCAAGCACAAATCTCACACCCGAAGTCATGTCGGCTCTCATGGGCGGGCCGTCAGACGCCGATCTAATGAAGGCC
TCAATGGACATCATTTCGGCCCCTCTCGGCGATGGCGTCAGTCTCAGCGACAAGCTCGTTGCCTTTGACAACTTT
GAGCAGCTCATTGAAAATCTTGACAATGCCAACAACATGAGCAACCTCGGACTCTGGTCTCCACTGCTCCACCAG
CTGCATAGCGACGAAGCAGACTTGCGCAAAATGGCTGCTTGGTGCATTGGAACGGCCGTTCAGAACAACCAGCAG
ACCCAGGAACGCCTCCTCGCTGTCGGTGGCTTGCCCACCCTCGTTGCAATGGCCCTCGACACACAAAACAAGGAG
GATGTAAGGAGAAAGGCTGTCTATGCTCTCAGCTCTGCCTGCAGGAATTACCAACCTGCCATGGATGTCTGTTCT
GAGGAACTTACAAAAGCTGGTCATCTCACCAACGCCATCGACGCTGCCGATATGGAGGCTGTGGACAAGGTTATG
AACGCTTTGAGAGAAAAGGCACAAGCTGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail