Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2696
Gene name
LocationContig_200:12127..13187
Strand+
Gene length (bp)1060
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00673 Ribosomal_L5_C ribosomal L5P family C-terminus 7.8E-25 204 301
PF00281 Ribosomal_L5 Ribosomal protein L5 6.9E-09 146 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14337|RM07_SCHPO Probable 54S ribosomal protein L7, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl7 PE=3 SV=1 56 301 9.0E-38
sp|P36519|RM07_YEAST 54S ribosomal protein L7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL7 PE=1 SV=2 57 302 2.0E-34
sp|Q3A9S8|RL5_CARHZ 50S ribosomal protein L5 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplE PE=3 SV=1 145 301 6.0E-28
sp|Q1GPB1|RL5_SPHAL 50S ribosomal protein L5 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplE PE=3 SV=1 145 301 1.0E-27
sp|Q2S924|RL5_HAHCH 50S ribosomal protein L5 OS=Hahella chejuensis (strain KCTC 2396) GN=rplE PE=3 SV=1 134 301 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14337|RM07_SCHPO Probable 54S ribosomal protein L7, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl7 PE=3 SV=1 56 301 9.0E-38
sp|P36519|RM07_YEAST 54S ribosomal protein L7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL7 PE=1 SV=2 57 302 2.0E-34
sp|Q3A9S8|RL5_CARHZ 50S ribosomal protein L5 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplE PE=3 SV=1 145 301 6.0E-28
sp|Q1GPB1|RL5_SPHAL 50S ribosomal protein L5 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplE PE=3 SV=1 145 301 1.0E-27
sp|Q2S924|RL5_HAHCH 50S ribosomal protein L5 OS=Hahella chejuensis (strain KCTC 2396) GN=rplE PE=3 SV=1 134 301 1.0E-27
sp|A7HBN0|RL5_ANADF 50S ribosomal protein L5 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplE PE=3 SV=1 125 301 2.0E-27
sp|Q2W2K3|RL5_MAGSA 50S ribosomal protein L5 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplE PE=3 SV=1 135 301 3.0E-27
sp|A6TWH0|RL5_ALKMQ 50S ribosomal protein L5 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rplE PE=3 SV=1 145 301 4.0E-27
sp|A4IZS2|RL5_FRATW 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplE PE=3 SV=1 145 301 5.0E-27
sp|Q0BNR5|RL5_FRATO 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplE PE=3 SV=1 145 301 5.0E-27
sp|A0Q4J5|RL5_FRATN 50S ribosomal protein L5 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplE PE=3 SV=1 145 301 5.0E-27
sp|Q2A5F8|RL5_FRATH 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplE PE=3 SV=1 145 301 5.0E-27
sp|A7N9T7|RL5_FRATF 50S ribosomal protein L5 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplE PE=3 SV=1 145 301 5.0E-27
sp|Q5NHV6|RL5_FRATT 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplE PE=3 SV=1 145 301 5.0E-27
sp|Q14JA8|RL5_FRAT1 50S ribosomal protein L5 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplE PE=3 SV=1 145 301 5.0E-27
sp|B2SDX3|RL5_FRATM 50S ribosomal protein L5 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplE PE=3 SV=1 137 301 5.0E-27
sp|Q8YPJ1|RL5_NOSS1 50S ribosomal protein L5 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplE PE=3 SV=1 144 301 5.0E-27
sp|Q3MFA9|RL5_ANAVT 50S ribosomal protein L5 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplE PE=3 SV=1 144 301 6.0E-27
sp|B4UBB1|RL5_ANASK 50S ribosomal protein L5 OS=Anaeromyxobacter sp. (strain K) GN=rplE PE=3 SV=1 137 301 6.0E-27
sp|Q2IJ79|RL5_ANADE 50S ribosomal protein L5 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplE PE=3 SV=1 137 301 6.0E-27
sp|B8J872|RL5_ANAD2 50S ribosomal protein L5 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplE PE=3 SV=1 137 301 6.0E-27
sp|B0U0X7|RL5_FRAP2 50S ribosomal protein L5 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplE PE=3 SV=1 137 301 6.0E-27
sp|B2A4F1|RL5_NATTJ 50S ribosomal protein L5 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplE PE=3 SV=1 135 301 6.0E-27
sp|B9E9K3|RL5_MACCJ 50S ribosomal protein L5 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplE PE=3 SV=1 145 301 7.0E-27
sp|B8G6R3|RL5_CHLAD 50S ribosomal protein L5 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rplE PE=3 SV=1 134 301 9.0E-27
sp|Q2G8W8|RL5_NOVAD 50S ribosomal protein L5 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplE PE=3 SV=1 145 301 1.0E-26
sp|Q2RFQ9|RL5_MOOTA 50S ribosomal protein L5 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplE PE=3 SV=1 145 301 1.0E-26
sp|B0UX26|RL5_HISS2 50S ribosomal protein L5 OS=Histophilus somni (strain 2336) GN=rplE PE=3 SV=1 145 301 1.0E-26
sp|Q0I150|RL5_HAES1 50S ribosomal protein L5 OS=Haemophilus somnus (strain 129Pt) GN=rplE PE=3 SV=1 145 301 1.0E-26
sp|Q5WLQ0|RL5_BACSK 50S ribosomal protein L5 OS=Bacillus clausii (strain KSM-K16) GN=rplE PE=3 SV=1 146 301 1.0E-26
sp|B0JHZ1|RL5_MICAN 50S ribosomal protein L5 OS=Microcystis aeruginosa (strain NIES-843) GN=rplE PE=3 SV=1 142 301 2.0E-26
sp|B0BSU3|RL5_ACTPJ 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplE PE=3 SV=1 145 301 2.0E-26
sp|B3GZ23|RL5_ACTP7 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplE PE=3 SV=1 145 301 2.0E-26
sp|A3N369|RL5_ACTP2 50S ribosomal protein L5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplE PE=3 SV=1 145 301 2.0E-26
sp|Q8PC39|RL5_XANCP 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|B0RU70|RL5_XANCB 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|Q4URF1|RL5_XANC8 50S ribosomal protein L5 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|Q9CL42|RL5_PASMU 50S ribosomal protein L5 OS=Pasteurella multocida (strain Pm70) GN=rplE PE=3 SV=1 145 301 3.0E-26
sp|B6EPT7|RL5_ALISL 50S ribosomal protein L5 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|A1T0D0|RL5_PSYIN 50S ribosomal protein L5 OS=Psychromonas ingrahamii (strain 37) GN=rplE PE=3 SV=1 145 301 3.0E-26
sp|Q8PNR4|RL5_XANAC 50S ribosomal protein L5 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|A9MN60|RL5_SALAR 50S ribosomal protein L5 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|Q5M2C5|RL5_STRT2 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rplE PE=3 SV=1 146 301 3.0E-26
sp|Q5LXS3|RL5_STRT1 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rplE PE=3 SV=1 146 301 3.0E-26
sp|B5XNA5|RL5_KLEP3 50S ribosomal protein L5 OS=Klebsiella pneumoniae (strain 342) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|Q5GWU7|RL5_XANOR 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|B2SQS2|RL5_XANOP 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|Q2NZZ7|RL5_XANOM 50S ribosomal protein L5 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplE PE=3 SV=1 130 301 3.0E-26
sp|Q03IG3|RL5_STRTD 50S ribosomal protein L5 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rplE PE=3 SV=1 146 301 3.0E-26
sp|B9DSW2|RL5_STRU0 50S ribosomal protein L5 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rplE PE=3 SV=1 142 301 4.0E-26
sp|B9LJE4|RL5_CHLSY 50S ribosomal protein L5 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rplE PE=3 SV=1 134 301 4.0E-26
sp|A9WH78|RL5_CHLAA 50S ribosomal protein L5 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rplE PE=3 SV=1 134 301 4.0E-26
sp|P62405|RL5_SALTY 50S ribosomal protein L5 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplE PE=3 SV=2 137 301 4.0E-26
sp|P62404|RL5_SALTI 50S ribosomal protein L5 OS=Salmonella typhi GN=rplE PE=3 SV=2 137 301 4.0E-26
sp|B4TXD0|RL5_SALSV 50S ribosomal protein L5 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|B5BGX4|RL5_SALPK 50S ribosomal protein L5 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|C0Q0A4|RL5_SALPC 50S ribosomal protein L5 OS=Salmonella paratyphi C (strain RKS4594) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|A9MSY6|RL5_SALPB 50S ribosomal protein L5 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|Q5PIU5|RL5_SALPA 50S ribosomal protein L5 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|B4SUS8|RL5_SALNS 50S ribosomal protein L5 OS=Salmonella newport (strain SL254) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|B4TKK3|RL5_SALHS 50S ribosomal protein L5 OS=Salmonella heidelberg (strain SL476) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|B5RH27|RL5_SALG2 50S ribosomal protein L5 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|B5R279|RL5_SALEP 50S ribosomal protein L5 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|B5FJK2|RL5_SALDC 50S ribosomal protein L5 OS=Salmonella dublin (strain CT_02021853) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|Q57J44|RL5_SALCH 50S ribosomal protein L5 OS=Salmonella choleraesuis (strain SC-B67) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|B5F7T3|RL5_SALA4 50S ribosomal protein L5 OS=Salmonella agona (strain SL483) GN=rplE PE=3 SV=1 137 301 4.0E-26
sp|Q3BWX1|RL5_XANC5 50S ribosomal protein L5 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplE PE=3 SV=1 130 301 4.0E-26
sp|Q9A8U1|RL5_CAUCR 50S ribosomal protein L5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplE PE=3 SV=1 145 301 4.0E-26
sp|B8H4E6|RL5_CAUCN 50S ribosomal protein L5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplE PE=3 SV=1 145 301 4.0E-26
sp|B9DM35|RL5_STACT 50S ribosomal protein L5 OS=Staphylococcus carnosus (strain TM300) GN=rplE PE=3 SV=1 145 301 4.0E-26
sp|Q2RQX2|RL5_RHORT 50S ribosomal protein L5 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplE PE=3 SV=1 145 301 5.0E-26
sp|B2ITP3|RL5_NOSP7 50S ribosomal protein L5 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rplE PE=3 SV=1 145 301 5.0E-26
sp|B7VLE5|RL5_VIBTL 50S ribosomal protein L5 OS=Vibrio tasmaniensis (strain LGP32) GN=rplE PE=3 SV=1 130 301 5.0E-26
sp|B5EFR2|RL5_GEOBB 50S ribosomal protein L5 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplE PE=3 SV=1 145 301 6.0E-26
sp|A7NR51|RL5_ROSCS 50S ribosomal protein L5 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rplE PE=3 SV=1 123 301 6.0E-26
sp|B8F6Q9|RL5_HAEPS 50S ribosomal protein L5 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplE PE=3 SV=1 145 301 7.0E-26
sp|B1VEW6|RL5_CORU7 50S ribosomal protein L5 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rplE PE=3 SV=1 137 304 7.0E-26
sp|A7HWS3|RL5_PARL1 50S ribosomal protein L5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplE PE=3 SV=1 119 301 7.0E-26
sp|B5FG21|RL5_VIBFM 50S ribosomal protein L5 OS=Vibrio fischeri (strain MJ11) GN=rplE PE=3 SV=1 130 301 8.0E-26
sp|P44346|RL5_HAEIN 50S ribosomal protein L5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplE PE=3 SV=2 145 301 8.0E-26
sp|A5UHU3|RL5_HAEIG 50S ribosomal protein L5 OS=Haemophilus influenzae (strain PittGG) GN=rplE PE=3 SV=1 145 301 8.0E-26
sp|A5UDT5|RL5_HAEIE 50S ribosomal protein L5 OS=Haemophilus influenzae (strain PittEE) GN=rplE PE=3 SV=1 145 301 8.0E-26
sp|Q4QMA9|RL5_HAEI8 50S ribosomal protein L5 OS=Haemophilus influenzae (strain 86-028NP) GN=rplE PE=3 SV=1 145 301 8.0E-26
sp|C5BGL3|RL5_EDWI9 50S ribosomal protein L5 OS=Edwardsiella ictaluri (strain 93-146) GN=rplE PE=3 SV=1 137 301 8.0E-26
sp|A9WSU5|RL5_RENSM 50S ribosomal protein L5 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rplE PE=3 SV=1 141 301 8.0E-26
sp|Q7VKE5|RL5_HAEDU 50S ribosomal protein L5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplE PE=3 SV=1 145 301 8.0E-26
sp|C6E4P5|RL5_GEOSM 50S ribosomal protein L5 OS=Geobacter sp. (strain M21) GN=rplE PE=3 SV=1 145 301 8.0E-26
sp|Q7A083|RL5_STAAW 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MW2) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|A8Z345|RL5_STAAT 50S ribosomal protein L5 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|Q6G783|RL5_STAAS 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MSSA476) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|Q6GEJ5|RL5_STAAR 50S ribosomal protein L5 OS=Staphylococcus aureus (strain MRSA252) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|Q7A465|RL5_STAAN 50S ribosomal protein L5 OS=Staphylococcus aureus (strain N315) GN=rplE PE=1 SV=1 145 301 9.0E-26
sp|Q99S33|RL5_STAAM 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|A6QJ80|RL5_STAAE 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Newman) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|Q5HDX0|RL5_STAAC 50S ribosomal protein L5 OS=Staphylococcus aureus (strain COL) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|Q2YYK9|RL5_STAAB 50S ribosomal protein L5 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|A5IV22|RL5_STAA9 50S ribosomal protein L5 OS=Staphylococcus aureus (strain JH9) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|Q2FW18|RL5_STAA8 50S ribosomal protein L5 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplE PE=1 SV=1 145 301 9.0E-26
sp|Q2FEQ1|RL5_STAA3 50S ribosomal protein L5 OS=Staphylococcus aureus (strain USA300) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|A6U3W3|RL5_STAA2 50S ribosomal protein L5 OS=Staphylococcus aureus (strain JH1) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|A7X5E5|RL5_STAA1 50S ribosomal protein L5 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplE PE=3 SV=1 145 301 9.0E-26
sp|B0C1E5|RL5_ACAM1 50S ribosomal protein L5 OS=Acaryochloris marina (strain MBIC 11017) GN=rplE PE=3 SV=1 145 301 1.0E-25
sp|Q5NQ53|RL5_ZYMMO 50S ribosomal protein L5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplE PE=3 SV=1 145 301 1.0E-25
sp|A6VLK0|RL5_ACTSZ 50S ribosomal protein L5 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplE PE=3 SV=1 145 301 1.0E-25
sp|Q605C4|RL5_METCA 50S ribosomal protein L5 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplE PE=3 SV=1 145 301 1.0E-25
sp|B7GJ79|RL5_ANOFW 50S ribosomal protein L5 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplE PE=3 SV=1 145 301 1.0E-25
sp|Q31IX0|RL5_THICR 50S ribosomal protein L5 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplE PE=3 SV=1 147 301 2.0E-25
sp|Q890P8|RL5_CLOTE 50S ribosomal protein L5 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|Q49ZF6|RL5_STAS1 50S ribosomal protein L5 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplE PE=3 SV=1 145 302 2.0E-25
sp|A1W320|RL5_ACISJ 50S ribosomal protein L5 OS=Acidovorax sp. (strain JS42) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|B9MBU9|RL5_ACIET 50S ribosomal protein L5 OS=Acidovorax ebreus (strain TPSY) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|A5GAV4|RL5_GEOUR 50S ribosomal protein L5 OS=Geobacter uraniireducens (strain Rf4) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|Q0ANR2|RL5_MARMM 50S ribosomal protein L5 OS=Maricaulis maris (strain MCS10) GN=rplE PE=3 SV=1 146 301 2.0E-25
sp|A1S230|RL5_SHEAM 50S ribosomal protein L5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|A1TYK9|RL5_MARHV 50S ribosomal protein L5 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplE PE=3 SV=1 134 301 2.0E-25
sp|B2TII7|RL5_CLOBB 50S ribosomal protein L5 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|B2UYC2|RL5_CLOBA 50S ribosomal protein L5 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|Q7NEG4|RL5_GLOVI 50S ribosomal protein L5 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplE PE=3 SV=1 134 301 2.0E-25
sp|B0V6V7|RL5_ACIBY 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain AYE) GN=rplE PE=3 SV=1 137 301 2.0E-25
sp|A3M972|RL5_ACIBT 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplE PE=3 SV=2 137 301 2.0E-25
sp|B0VQT0|RL5_ACIBS 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain SDF) GN=rplE PE=3 SV=1 137 301 2.0E-25
sp|B7IA27|RL5_ACIB5 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain AB0057) GN=rplE PE=3 SV=1 137 301 2.0E-25
sp|B7GW14|RL5_ACIB3 50S ribosomal protein L5 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplE PE=3 SV=1 137 301 2.0E-25
sp|Q8DMM0|RL5_THEEB 50S ribosomal protein L5 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplE PE=3 SV=1 142 301 2.0E-25
sp|B1KMX1|RL5_SHEWM 50S ribosomal protein L5 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplE PE=3 SV=1 135 301 2.0E-25
sp|Q9Z9K2|RL5_BACHD 50S ribosomal protein L5 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplE PE=3 SV=1 146 301 2.0E-25
sp|Q6B8W5|RK5_GRATL 50S ribosomal protein L5, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl5 PE=3 SV=1 145 301 2.0E-25
sp|A8G1D6|RL5_SHESH 50S ribosomal protein L5 OS=Shewanella sediminis (strain HAW-EB3) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|Q2JQN2|RL5_SYNJA 50S ribosomal protein L5 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplE PE=3 SV=1 134 301 2.0E-25
sp|Q3IJJ7|RL5_PSEHT 50S ribosomal protein L5 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|Q6F7S4|RL5_ACIAD 50S ribosomal protein L5 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplE PE=3 SV=1 145 301 2.0E-25
sp|B8HMR6|RL5_CYAP4 50S ribosomal protein L5 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplE PE=3 SV=1 142 301 3.0E-25
sp|Q2JIL5|RL5_SYNJB 50S ribosomal protein L5 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplE PE=3 SV=1 134 301 3.0E-25
sp|Q03EC8|RL5_PEDPA 50S ribosomal protein L5 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|B1HMW8|RL5_LYSSC 50S ribosomal protein L5 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|Q65QW7|RL5_MANSM 50S ribosomal protein L5 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|B1KSL3|RL5_CLOBM 50S ribosomal protein L5 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|A7GJ62|RL5_CLOBL 50S ribosomal protein L5 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|B1IGE2|RL5_CLOBK 50S ribosomal protein L5 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|C1FMT9|RL5_CLOBJ 50S ribosomal protein L5 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|A5I7J4|RL5_CLOBH 50S ribosomal protein L5 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|C3KVN9|RL5_CLOB6 50S ribosomal protein L5 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|A7FZ57|RL5_CLOB1 50S ribosomal protein L5 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|A4J123|RL5_DESRM 50S ribosomal protein L5 OS=Desulfotomaculum reducens (strain MI-1) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|B0T2D4|RL5_CAUSK 50S ribosomal protein L5 OS=Caulobacter sp. (strain K31) GN=rplE PE=3 SV=1 145 301 3.0E-25
sp|A0KF33|RL5_AERHH 50S ribosomal protein L5 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplE PE=3 SV=1 142 301 4.0E-25
sp|A1TJS9|RL5_ACIAC 50S ribosomal protein L5 OS=Acidovorax citrulli (strain AAC00-1) GN=rplE PE=3 SV=1 145 301 4.0E-25
sp|Q4L8A2|RL5_STAHJ 50S ribosomal protein L5 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplE PE=3 SV=1 145 301 4.0E-25
sp|B8CNE5|RL5_SHEPW 50S ribosomal protein L5 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplE PE=3 SV=1 145 301 4.0E-25
sp|Q820Q9|RL5_NITEU 50S ribosomal protein L5 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplE PE=3 SV=1 142 301 4.0E-25
sp|B0TC68|RL5_HELMI 50S ribosomal protein L5 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplE PE=3 SV=1 145 301 4.0E-25
sp|Q97EJ0|RL5_CLOAB 50S ribosomal protein L5 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rplE PE=3 SV=1 145 301 4.0E-25
sp|C5CGJ0|RL5_KOSOT 50S ribosomal protein L5 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplE PE=3 SV=1 145 301 4.0E-25
sp|B1MW02|RL5_LEUCK 50S ribosomal protein L5 OS=Leuconostoc citreum (strain KM20) GN=rplE PE=3 SV=1 147 301 4.0E-25
sp|B1XJS7|RL5_SYNP2 50S ribosomal protein L5 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplE PE=3 SV=1 144 301 4.0E-25
sp|A4SSZ4|RL5_AERS4 50S ribosomal protein L5 OS=Aeromonas salmonicida (strain A449) GN=rplE PE=3 SV=1 142 301 4.0E-25
sp|Q8E2C2|RL5_STRA5 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rplE PE=3 SV=1 146 301 4.0E-25
sp|Q8E7S9|RL5_STRA3 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rplE PE=3 SV=1 146 301 4.0E-25
sp|Q3K3V7|RL5_STRA1 50S ribosomal protein L5 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rplE PE=3 SV=1 146 301 4.0E-25
sp|Q2NQN4|RL5_SODGM 50S ribosomal protein L5 OS=Sodalis glossinidius (strain morsitans) GN=rplE PE=3 SV=1 145 301 4.0E-25
sp|C0MCC2|RL5_STRS7 50S ribosomal protein L5 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rplE PE=3 SV=1 146 301 4.0E-25
sp|B4U512|RL5_STREM 50S ribosomal protein L5 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rplE PE=3 SV=1 146 301 4.0E-25
sp|C0M9H3|RL5_STRE4 50S ribosomal protein L5 OS=Streptococcus equi subsp. equi (strain 4047) GN=rplE PE=3 SV=1 146 301 4.0E-25
sp|C3LRP6|RL5_VIBCM 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplE PE=3 SV=1 130 301 5.0E-25
sp|Q9KNZ6|RL5_VIBCH 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplE PE=3 SV=1 130 301 5.0E-25
sp|A5F554|RL5_VIBC3 50S ribosomal protein L5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplE PE=3 SV=1 130 301 5.0E-25
sp|A4WFB6|RL5_ENT38 50S ribosomal protein L5 OS=Enterobacter sp. (strain 638) GN=rplE PE=3 SV=1 130 301 5.0E-25
sp|Q250M0|RL5_DESHY 50S ribosomal protein L5 OS=Desulfitobacterium hafniense (strain Y51) GN=rplE PE=3 SV=1 135 301 5.0E-25
sp|C4ZBT1|RL5_EUBR3 50S ribosomal protein L5 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rplE PE=3 SV=1 145 301 5.0E-25
sp|B8G1X8|RL5_DESHD 50S ribosomal protein L5 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplE PE=3 SV=1 135 301 5.0E-25
sp|A7N0I9|RL5_VIBCB 50S ribosomal protein L5 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplE PE=3 SV=1 130 301 6.0E-25
sp|B1YGW2|RL5_EXIS2 50S ribosomal protein L5 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rplE PE=3 SV=1 147 301 6.0E-25
sp|Q02W36|RL5_LACLS 50S ribosomal protein L5 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplE PE=3 SV=1 146 301 6.0E-25
sp|A2RNP3|RL5_LACLM 50S ribosomal protein L5 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplE PE=3 SV=1 146 301 6.0E-25
sp|Q9CDX4|RL5_LACLA 50S ribosomal protein L5 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplE PE=3 SV=1 146 301 6.0E-25
sp|A0KRN6|RL5_SHESA 50S ribosomal protein L5 OS=Shewanella sp. (strain ANA-3) GN=rplE PE=3 SV=1 145 301 6.0E-25
sp|A3Q994|RL5_SHELP 50S ribosomal protein L5 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplE PE=3 SV=1 145 301 6.0E-25
sp|Q39XZ4|RL5_GEOMG 50S ribosomal protein L5 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplE PE=3 SV=1 130 301 6.0E-25
sp|A5GVX2|RL5_SYNR3 50S ribosomal protein L5 OS=Synechococcus sp. (strain RCC307) GN=rplE PE=3 SV=1 135 301 6.0E-25
sp|B2GDV7|RL5_LACF3 50S ribosomal protein L5 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplE PE=3 SV=1 147 301 6.0E-25
sp|Q8DS25|RL5_STRMU 50S ribosomal protein L5 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rplE PE=3 SV=1 146 301 7.0E-25
sp|A7GK32|RL5_BACCN 50S ribosomal protein L5 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplE PE=3 SV=1 145 301 7.0E-25
sp|Q5E8A2|RL5_VIBF1 50S ribosomal protein L5 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplE PE=3 SV=1 130 301 7.0E-25
sp|Q839F2|RL5_ENTFA 50S ribosomal protein L5 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplE PE=3 SV=1 147 301 7.0E-25
sp|Q8CRH2|RL5_STAES 50S ribosomal protein L5 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplE PE=3 SV=1 145 301 7.0E-25
sp|Q5HM11|RL5_STAEQ 50S ribosomal protein L5 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplE PE=3 SV=1 145 301 7.0E-25
sp|A0PXV8|RL5_CLONN 50S ribosomal protein L5 OS=Clostridium novyi (strain NT) GN=rplE PE=3 SV=1 145 301 8.0E-25
sp|Q6CZY2|RL5_PECAS 50S ribosomal protein L5 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplE PE=3 SV=1 137 301 9.0E-25
sp|A9KJI2|RL5_CLOPH 50S ribosomal protein L5 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|B5XJ48|RL5_STRPZ 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rplE PE=3 SV=1 146 301 1.0E-24
sp|Q089P2|RL5_SHEFN 50S ribosomal protein L5 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|Q1AU41|RL5_RUBXD 50S ribosomal protein L5 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|A9B423|RL5_HERA2 50S ribosomal protein L5 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|A1WKA4|RL5_VEREI 50S ribosomal protein L5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rplE PE=3 SV=1 134 301 1.0E-24
sp|Q47LK5|RL5_THEFY 50S ribosomal protein L5 OS=Thermobifida fusca (strain YX) GN=rplE PE=3 SV=1 123 301 1.0E-24
sp|Q6LVA4|RL5_PHOPR 50S ribosomal protein L5 OS=Photobacterium profundum GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|B0TM00|RL5_SHEHH 50S ribosomal protein L5 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|P38517|RL5_THEMA 50S ribosomal protein L5 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplE PE=3 SV=2 134 301 1.0E-24
sp|A9KWB4|RL5_SHEB9 50S ribosomal protein L5 OS=Shewanella baltica (strain OS195) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|A6WHU0|RL5_SHEB8 50S ribosomal protein L5 OS=Shewanella baltica (strain OS185) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|A3DA60|RL5_SHEB5 50S ribosomal protein L5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|B8EBJ3|RL5_SHEB2 50S ribosomal protein L5 OS=Shewanella baltica (strain OS223) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|A8GYY8|RL5_SHEPA 50S ribosomal protein L5 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|Q5FTZ5|RL5_GLUOX 50S ribosomal protein L5 OS=Gluconobacter oxydans (strain 621H) GN=rplE PE=3 SV=1 145 301 1.0E-24
sp|A1ALV3|RL5_PELPD 50S ribosomal protein L5 OS=Pelobacter propionicus (strain DSM 2379) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|Q0I093|RL5_SHESR 50S ribosomal protein L5 OS=Shewanella sp. (strain MR-7) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|Q0HNS5|RL5_SHESM 50S ribosomal protein L5 OS=Shewanella sp. (strain MR-4) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|C4KZN4|RL5_EXISA 50S ribosomal protein L5 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|B1LBM8|RL5_THESQ 50S ribosomal protein L5 OS=Thermotoga sp. (strain RQ2) GN=rplE PE=3 SV=1 134 301 2.0E-24
sp|Q88QM3|RL5_PSEPK 50S ribosomal protein L5 OS=Pseudomonas putida (strain KT2440) GN=rplE PE=3 SV=1 135 301 2.0E-24
sp|B0KK79|RL5_PSEPG 50S ribosomal protein L5 OS=Pseudomonas putida (strain GB-1) GN=rplE PE=3 SV=1 135 301 2.0E-24
sp|A5VXQ9|RL5_PSEP1 50S ribosomal protein L5 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplE PE=3 SV=1 135 301 2.0E-24
sp|B7K236|RL5_CYAP8 50S ribosomal protein L5 OS=Cyanothece sp. (strain PCC 8801) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|Q7NQG4|RL5_CHRVO 50S ribosomal protein L5 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplE PE=3 SV=1 130 301 2.0E-24
sp|Q6HPP6|RL5_BACHK 50S ribosomal protein L5 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|Q63H78|RL5_BACCZ 50S ribosomal protein L5 OS=Bacillus cereus (strain ZK / E33L) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|Q81J30|RL5_BACCR 50S ribosomal protein L5 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|B7HJ60|RL5_BACC4 50S ribosomal protein L5 OS=Bacillus cereus (strain B4264) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|C1ET51|RL5_BACC3 50S ribosomal protein L5 OS=Bacillus cereus (strain 03BB102) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|B7JKD1|RL5_BACC0 50S ribosomal protein L5 OS=Bacillus cereus (strain AH820) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|Q81VR8|RL5_BACAN 50S ribosomal protein L5 OS=Bacillus anthracis GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|A0R8J2|RL5_BACAH 50S ribosomal protein L5 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|C3LJ94|RL5_BACAC 50S ribosomal protein L5 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|C3P9R7|RL5_BACAA 50S ribosomal protein L5 OS=Bacillus anthracis (strain A0248) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|P0DE57|RL5_STRPQ 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|Q48VT7|RL5_STRPM 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|A2RC26|RL5_STRPG 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|Q1J901|RL5_STRPF 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|Q1JJ50|RL5_STRPD 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|Q1JP05|RL5_STRPC 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|Q1JE46|RL5_STRPB 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|Q7CNP5|RL5_STRP8 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|Q5XEC3|RL5_STRP6 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|P0DE56|RL5_STRP3 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|Q9A1W2|RL5_STRP1 50S ribosomal protein L5 OS=Streptococcus pyogenes serotype M1 GN=rplE PE=3 SV=1 146 301 2.0E-24
sp|Q8R7W6|RL5_CALS4 50S ribosomal protein L5 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|A9BRW3|RL5_DELAS 50S ribosomal protein L5 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|Q8EK57|RL5_SHEON 50S ribosomal protein L5 OS=Shewanella oneidensis (strain MR-1) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|A7Z0Q0|RL5_BACMF 50S ribosomal protein L5 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|A1REC6|RL5_SHESW 50S ribosomal protein L5 OS=Shewanella sp. (strain W3-18-1) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|A4YBX1|RL5_SHEPC 50S ribosomal protein L5 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplE PE=3 SV=1 145 301 2.0E-24
sp|B1JAK0|RL5_PSEPW 50S ribosomal protein L5 OS=Pseudomonas putida (strain W619) GN=rplE PE=3 SV=1 135 301 3.0E-24
sp|Q5L411|RL5_GEOKA 50S ribosomal protein L5 OS=Geobacillus kaustophilus (strain HTA426) GN=rplE PE=3 SV=1 145 301 3.0E-24
sp|Q1LTC6|RL5_BAUCH 50S ribosomal protein L5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplE PE=3 SV=1 145 301 3.0E-24
sp|C5D3S9|RL5_GEOSW 50S ribosomal protein L5 OS=Geobacillus sp. (strain WCH70) GN=rplE PE=3 SV=1 142 301 3.0E-24
sp|Q65P95|RL5_BACLD 50S ribosomal protein L5 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplE PE=3 SV=1 145 301 3.0E-24
sp|Q110B9|RL5_TRIEI 50S ribosomal protein L5 OS=Trichodesmium erythraeum (strain IMS101) GN=rplE PE=3 SV=1 142 301 3.0E-24
sp|B0K5Q5|RL5_THEPX 50S ribosomal protein L5 OS=Thermoanaerobacter sp. (strain X514) GN=rplE PE=3 SV=1 145 301 3.0E-24
sp|B0KCL2|RL5_THEP3 50S ribosomal protein L5 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplE PE=3 SV=1 145 301 3.0E-24
sp|B8I7Z1|RL5_CLOCE 50S ribosomal protein L5 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rplE PE=3 SV=1 145 301 3.0E-24
sp|Q1IFV4|RL5_PSEE4 50S ribosomal protein L5 OS=Pseudomonas entomophila (strain L48) GN=rplE PE=3 SV=1 135 301 3.0E-24
sp|A0JZ72|RL5_ARTS2 50S ribosomal protein L5 OS=Arthrobacter sp. (strain FB24) GN=rplE PE=3 SV=1 144 301 3.0E-24
sp|A4VSG6|RL5_STRSY 50S ribosomal protein L5 OS=Streptococcus suis (strain 05ZYH33) GN=rplE PE=3 SV=1 146 301 3.0E-24
sp|A4VYQ5|RL5_STRS2 50S ribosomal protein L5 OS=Streptococcus suis (strain 98HAH33) GN=rplE PE=3 SV=1 146 301 3.0E-24
sp|Q03ZN3|RL5_LEUMM 50S ribosomal protein L5 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rplE PE=3 SV=1 147 301 3.0E-24
sp|Q1R0G3|RL5_CHRSD 50S ribosomal protein L5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplE PE=3 SV=1 145 301 4.0E-24
sp|Q4JT81|RL5_CORJK 50S ribosomal protein L5 OS=Corynebacterium jeikeium (strain K411) GN=rplE PE=3 SV=1 145 304 4.0E-24
sp|C4L7U2|RL5_TOLAT 50S ribosomal protein L5 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplE PE=3 SV=1 145 301 4.0E-24
sp|Q9PE64|RL5_XYLFA 50S ribosomal protein L5 OS=Xylella fastidiosa (strain 9a5c) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|C1CPA0|RL5_STRZT 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|C1CIA9|RL5_STRZP 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain P1031) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|C1CC18|RL5_STRZJ 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain JJA) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|Q8CWV4|RL5_STRR6 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|B2IS52|RL5_STRPS 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain CGSP14) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|Q97SV1|RL5_STRPN 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|B8ZKG9|RL5_STRPJ 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|B1I8L0|RL5_STRPI 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|C1CAM4|RL5_STRP7 50S ribosomal protein L5 OS=Streptococcus pneumoniae (strain 70585) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|B5E6G7|RL5_STRP4 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|Q04MM4|RL5_STRP2 50S ribosomal protein L5 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|Q8RIG8|RL5_FUSNN 50S ribosomal protein L5 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rplE PE=3 SV=1 134 301 4.0E-24
sp|Q87E70|RL5_XYLFT 50S ribosomal protein L5 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|B2I8I1|RL5_XYLF2 50S ribosomal protein L5 OS=Xylella fastidiosa (strain M23) GN=rplE PE=3 SV=1 146 301 4.0E-24
sp|P73308|RL5_SYNY3 50S ribosomal protein L5 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplE PE=3 SV=2 134 301 4.0E-24
sp|Q8K962|RL5_BUCAP 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplE PE=3 SV=1 130 301 4.0E-24
sp|Q01WA4|RL5_SOLUE 50S ribosomal protein L5 OS=Solibacter usitatus (strain Ellin6076) GN=rplE PE=3 SV=1 134 301 4.0E-24
sp|P08895|RL5_GEOSE 50S ribosomal protein L5 OS=Geobacillus stearothermophilus GN=rplE PE=1 SV=1 142 301 4.0E-24
sp|A8AQK4|RL5_CITK8 50S ribosomal protein L5 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rplE PE=3 SV=1 137 301 4.0E-24
sp|P12877|RL5_BACSU 50S ribosomal protein L5 OS=Bacillus subtilis (strain 168) GN=rplE PE=1 SV=1 145 301 5.0E-24
sp|Q3YWV1|RL5_SHISS 50S ribosomal protein L5 OS=Shigella sonnei (strain Ss046) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|Q0SZZ4|RL5_SHIF8 50S ribosomal protein L5 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|Q32B43|RL5_SHIDS 50S ribosomal protein L5 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|Q31VW8|RL5_SHIBS 50S ribosomal protein L5 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B2U2S6|RL5_SHIB3 50S ribosomal protein L5 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|A6TEW0|RL5_KLEP7 50S ribosomal protein L5 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|A4IJK0|RL5_GEOTN 50S ribosomal protein L5 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|B7LRS4|RL5_ESCF3 50S ribosomal protein L5 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|Q1R620|RL5_ECOUT 50S ribosomal protein L5 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B1LHC2|RL5_ECOSM 50S ribosomal protein L5 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B6I222|RL5_ECOSE 50S ribosomal protein L5 OS=Escherichia coli (strain SE11) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B7NDS9|RL5_ECOLU 50S ribosomal protein L5 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|P62399|RL5_ECOLI 50S ribosomal protein L5 OS=Escherichia coli (strain K12) GN=rplE PE=1 SV=2 130 301 5.0E-24
sp|B1IPZ1|RL5_ECOLC 50S ribosomal protein L5 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|P62400|RL5_ECOL6 50S ribosomal protein L5 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplE PE=3 SV=2 130 301 5.0E-24
sp|Q0TCF3|RL5_ECOL5 50S ribosomal protein L5 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|A1AGJ7|RL5_ECOK1 50S ribosomal protein L5 OS=Escherichia coli O1:K1 / APEC GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|A8A5B3|RL5_ECOHS 50S ribosomal protein L5 OS=Escherichia coli O9:H4 (strain HS) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B1X6G0|RL5_ECODH 50S ribosomal protein L5 OS=Escherichia coli (strain K12 / DH10B) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|C4ZUG3|RL5_ECOBW 50S ribosomal protein L5 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B7M1M2|RL5_ECO8A 50S ribosomal protein L5 OS=Escherichia coli O8 (strain IAI1) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B7N192|RL5_ECO81 50S ribosomal protein L5 OS=Escherichia coli O81 (strain ED1a) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B7NLM7|RL5_ECO7I 50S ribosomal protein L5 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B5YTM9|RL5_ECO5E 50S ribosomal protein L5 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|P62401|RL5_ECO57 50S ribosomal protein L5 OS=Escherichia coli O157:H7 GN=rplE PE=3 SV=2 130 301 5.0E-24
sp|B7L4J7|RL5_ECO55 50S ribosomal protein L5 OS=Escherichia coli (strain 55989 / EAEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B7MCS3|RL5_ECO45 50S ribosomal protein L5 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B7UK32|RL5_ECO27 50S ribosomal protein L5 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|A7ZSJ7|RL5_ECO24 50S ribosomal protein L5 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|C1DKM5|RL5_AZOVD 50S ribosomal protein L5 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rplE PE=3 SV=1 141 301 5.0E-24
sp|Q2S3Q2|RL5_SALRD 50S ribosomal protein L5 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplE PE=3 SV=1 145 308 5.0E-24
sp|Q0SQF6|RL5_CLOPS 50S ribosomal protein L5 OS=Clostridium perfringens (strain SM101 / Type A) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|Q8XHT5|RL5_CLOPE 50S ribosomal protein L5 OS=Clostridium perfringens (strain 13 / Type A) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|Q0TMQ8|RL5_CLOP1 50S ribosomal protein L5 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|A7MPH6|RL5_CROS8 50S ribosomal protein L5 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|Q88XX4|RL5_LACPL 50S ribosomal protein L5 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|O67568|RL5_AQUAE 50S ribosomal protein L5 OS=Aquifex aeolicus (strain VF5) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|Q6XYX6|RL5_SPIKU 50S ribosomal protein L5 OS=Spiroplasma kunkelii GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|Q89A78|RL5_BUCBP 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|Q4FUE4|RL5_PSYA2 50S ribosomal protein L5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|B4R8M9|RL5_PHEZH 50S ribosomal protein L5 OS=Phenylobacterium zucineum (strain HLK1) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|Q83ER4|RL5_COXBU 50S ribosomal protein L5 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|A9KD19|RL5_COXBN 50S ribosomal protein L5 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B6J251|RL5_COXB2 50S ribosomal protein L5 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|B6J5E4|RL5_COXB1 50S ribosomal protein L5 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplE PE=3 SV=1 135 301 5.0E-24
sp|B1I1K0|RL5_DESAP 50S ribosomal protein L5 OS=Desulforudis audaxviator (strain MP104C) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|A5WCK2|RL5_PSYWF 50S ribosomal protein L5 OS=Psychrobacter sp. (strain PRwf-1) GN=rplE PE=3 SV=1 145 301 5.0E-24
sp|Q1LI49|RL5_CUPMC 50S ribosomal protein L5 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplE PE=3 SV=1 130 301 5.0E-24
sp|Q30Z54|RL5_DESAG 50S ribosomal protein L5 OS=Desulfovibrio alaskensis (strain G20) GN=rplE PE=3 SV=1 135 301 6.0E-24
sp|A8F997|RL5_BACP2 50S ribosomal protein L5 OS=Bacillus pumilus (strain SAFR-032) GN=rplE PE=3 SV=1 145 301 6.0E-24
sp|B9IZK6|RL5_BACCQ 50S ribosomal protein L5 OS=Bacillus cereus (strain Q1) GN=rplE PE=3 SV=1 145 301 6.0E-24
sp|B7HQV6|RL5_BACC7 50S ribosomal protein L5 OS=Bacillus cereus (strain AH187) GN=rplE PE=3 SV=1 145 301 6.0E-24
sp|Q73F84|RL5_BACC1 50S ribosomal protein L5 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplE PE=3 SV=1 145 301 6.0E-24
sp|A1R8T3|RL5_ARTAT 50S ribosomal protein L5 OS=Arthrobacter aurescens (strain TC1) GN=rplE PE=3 SV=1 144 301 6.0E-24
sp|B2FQJ6|RL5_STRMK 50S ribosomal protein L5 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplE PE=3 SV=1 130 301 6.0E-24
sp|A9NAY2|RL5_COXBR 50S ribosomal protein L5 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplE PE=3 SV=1 135 301 6.0E-24
sp|B9M6G6|RL5_GEODF 50S ribosomal protein L5 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplE PE=3 SV=1 145 301 6.0E-24
sp|A5V5Z0|RL5_SPHWW 50S ribosomal protein L5 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplE PE=3 SV=1 144 301 6.0E-24
sp|Q87T01|RL5_VIBPA 50S ribosomal protein L5 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplE PE=3 SV=1 130 301 6.0E-24
sp|B0U5L1|RL5_XYLFM 50S ribosomal protein L5 OS=Xylella fastidiosa (strain M12) GN=rplE PE=3 SV=1 146 301 7.0E-24
sp|Q7MPH6|RL5_VIBVY 50S ribosomal protein L5 OS=Vibrio vulnificus (strain YJ016) GN=rplE PE=3 SV=1 130 301 8.0E-24
sp|Q8DE51|RL5_VIBVU 50S ribosomal protein L5 OS=Vibrio vulnificus (strain CMCP6) GN=rplE PE=3 SV=2 130 301 8.0E-24
sp|Q1QDH4|RL5_PSYCK 50S ribosomal protein L5 OS=Psychrobacter cryohalolentis (strain K5) GN=rplE PE=3 SV=1 145 301 8.0E-24
sp|B7IT31|RL5_BACC2 50S ribosomal protein L5 OS=Bacillus cereus (strain G9842) GN=rplE PE=3 SV=1 145 301 8.0E-24
sp|Q0ABG3|RL5_ALKEH 50S ribosomal protein L5 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rplE PE=3 SV=1 145 301 9.0E-24
sp|Q9HWE7|RL5_PSEAE 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplE PE=3 SV=1 145 301 9.0E-24
sp|Q02T68|RL5_PSEAB 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplE PE=3 SV=1 145 301 9.0E-24
sp|B7V656|RL5_PSEA8 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplE PE=3 SV=1 145 301 9.0E-24
sp|A9VP89|RL5_BACWK 50S ribosomal protein L5 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplE PE=3 SV=1 145 301 9.0E-24
sp|B4SKX5|RL5_STRM5 50S ribosomal protein L5 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplE PE=3 SV=1 130 301 9.0E-24
sp|C0ZIJ2|RL5_BREBN 50S ribosomal protein L5 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplE PE=3 SV=1 142 301 9.0E-24
sp|A3CK75|RL5_STRSV 50S ribosomal protein L5 OS=Streptococcus sanguinis (strain SK36) GN=rplE PE=3 SV=1 146 301 9.0E-24
sp|B9KLA3|RL5_RHOSK 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplE PE=3 SV=1 145 301 1.0E-23
sp|Q3J5R0|RL5_RHOS4 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplE PE=3 SV=1 145 301 1.0E-23
sp|C3PL19|RL5_CORA7 50S ribosomal protein L5 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=rplE PE=3 SV=1 145 301 1.0E-23
sp|A6UZK0|RL5_PSEA7 50S ribosomal protein L5 OS=Pseudomonas aeruginosa (strain PA7) GN=rplE PE=3 SV=1 145 301 1.0E-23
sp|A8AZL3|RL5_STRGC 50S ribosomal protein L5 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplE PE=3 SV=1 146 301 1.0E-23
sp|A3PGM3|RL5_RHOS1 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplE PE=3 SV=1 145 301 1.0E-23
sp|B2VK52|RL5_ERWT9 50S ribosomal protein L5 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplE PE=3 SV=1 130 301 1.0E-23
sp|Q3SLN7|RL5_THIDA 50S ribosomal protein L5 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplE PE=3 SV=1 145 301 1.0E-23
sp|B8HCZ4|RL5_ARTCA 50S ribosomal protein L5 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=rplE PE=3 SV=1 144 301 1.0E-23
sp|Q1WSA2|RL5_LACS1 50S ribosomal protein L5 OS=Lactobacillus salivarius (strain UCC118) GN=rplE PE=3 SV=1 147 301 1.0E-23
sp|Q04G73|RL5_OENOB 50S ribosomal protein L5 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rplE PE=3 SV=1 147 301 1.0E-23
sp|Q3Z969|RL5_DEHM1 50S ribosomal protein L5 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplE PE=3 SV=1 131 301 1.0E-23
sp|Q12SU7|RL5_SHEDO 50S ribosomal protein L5 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplE PE=3 SV=1 145 301 1.0E-23
sp|Q5P320|RL5_AROAE 50S ribosomal protein L5 OS=Aromatoleum aromaticum (strain EbN1) GN=rplE PE=3 SV=1 145 301 1.0E-23
sp|Q8FS69|RL5_COREF 50S ribosomal protein L5 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rplE PE=3 SV=1 123 301 1.0E-23
sp|Q5QXX0|RL5_IDILO 50S ribosomal protein L5 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplE PE=3 SV=1 130 301 2.0E-23
sp|B1JIX3|RL5_YERPY 50S ribosomal protein L5 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|Q664T3|RL5_YERPS 50S ribosomal protein L5 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A4TH04|RL5_YERPP 50S ribosomal protein L5 OS=Yersinia pestis (strain Pestoides F) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|Q1CCV6|RL5_YERPN 50S ribosomal protein L5 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A9R907|RL5_YERPG 50S ribosomal protein L5 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|Q8ZJA0|RL5_YERPE 50S ribosomal protein L5 OS=Yersinia pestis GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|B2K5L8|RL5_YERPB 50S ribosomal protein L5 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|Q1C2V9|RL5_YERPA 50S ribosomal protein L5 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A7FNM2|RL5_YERP3 50S ribosomal protein L5 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|P46178|RL5_BUCAK 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|Q3ZZL2|RL5_DEHMC 50S ribosomal protein L5 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A5FRX3|RL5_DEHMB 50S ribosomal protein L5 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A8GKI5|RL5_SERP5 50S ribosomal protein L5 OS=Serratia proteamaculans (strain 568) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|B4F1J6|RL5_PROMH 50S ribosomal protein L5 OS=Proteus mirabilis (strain HI4320) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A0ALV6|RL5_LISW6 50S ribosomal protein L5 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|Q927L9|RL5_LISMO 50S ribosomal protein L5 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|B8DB20|RL5_LISMH 50S ribosomal protein L5 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|Q71WF8|RL5_LISMF 50S ribosomal protein L5 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|C1KZG8|RL5_LISMC 50S ribosomal protein L5 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|Q7ANU7|RL5_LISIN 50S ribosomal protein L5 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A4WVJ6|RL5_RHOS5 50S ribosomal protein L5 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A6QCR0|RL5_SULNB 50S ribosomal protein L5 OS=Sulfurovum sp. (strain NBC37-1) GN=rplE PE=3 SV=1 147 301 2.0E-23
sp|Q03PW9|RL5_LACBA 50S ribosomal protein L5 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplE PE=3 SV=1 147 303 2.0E-23
sp|C5CC50|RL5_MICLC 50S ribosomal protein L5 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A1VEA4|RL5_DESVV 50S ribosomal protein L5 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplE PE=3 SV=1 134 301 2.0E-23
sp|Q72CG8|RL5_DESVH 50S ribosomal protein L5 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplE PE=3 SV=1 134 301 2.0E-23
sp|Q6MSN8|RL5_MYCMS 50S ribosomal protein L5 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplE PE=3 SV=1 122 301 2.0E-23
sp|Q1H4M5|RL5_METFK 50S ribosomal protein L5 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|A6T3J2|RL5_JANMA 50S ribosomal protein L5 OS=Janthinobacterium sp. (strain Marseille) GN=rplE PE=3 SV=1 145 301 2.0E-23
sp|Q0AUJ2|RL5_SYNWW 50S ribosomal protein L5 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplE PE=3 SV=1 145 301 3.0E-23
sp|B2S0J3|RL5_BORHD 50S ribosomal protein L5 OS=Borrelia hermsii (strain HS1 / DAH) GN=rplE PE=3 SV=1 147 301 3.0E-23
sp|A8MLF2|RL5_ALKOO 50S ribosomal protein L5 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplE PE=3 SV=1 145 301 3.0E-23
sp|A1VJ27|RL5_POLNA 50S ribosomal protein L5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rplE PE=3 SV=1 145 301 3.0E-23
sp|A4G9S6|RL5_HERAR 50S ribosomal protein L5 OS=Herminiimonas arsenicoxydans GN=rplE PE=3 SV=1 145 301 3.0E-23
sp|A6LPS3|RL5_CLOB8 50S ribosomal protein L5 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplE PE=3 SV=1 145 301 3.0E-23
sp|Q7U4I8|RL5_SYNPX 50S ribosomal protein L5 OS=Synechococcus sp. (strain WH8102) GN=rplE PE=3 SV=1 135 301 3.0E-23
sp|A2BYS4|RL5_PROM5 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplE PE=3 SV=1 145 301 3.0E-23
sp|Q7UZV6|RL5_PROMP 50S ribosomal protein L5 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplE PE=3 SV=1 145 301 3.0E-23
sp|Q2YAY5|RL5_NITMU 50S ribosomal protein L5 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplE PE=3 SV=1 145 301 3.0E-23
sp|C5BQ73|RL5_TERTT 50S ribosomal protein L5 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplE PE=3 SV=1 145 301 3.0E-23
sp|C5CQ88|RL5_VARPS 50S ribosomal protein L5 OS=Variovorax paradoxus (strain S110) GN=rplE PE=3 SV=1 145 301 4.0E-23
sp|Q3AMP2|RL5_SYNSC 50S ribosomal protein L5 OS=Synechococcus sp. (strain CC9605) GN=rplE PE=3 SV=1 135 301 4.0E-23
sp|A2C4Y7|RL5_PROM1 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain NATL1A) GN=rplE PE=3 SV=1 145 304 4.0E-23
sp|B7KHZ9|RL5_CYAP7 50S ribosomal protein L5 OS=Cyanothece sp. (strain PCC 7424) GN=rplE PE=3 SV=1 134 301 4.0E-23
sp|Q9ZCR7|RL5_RICPR 50S ribosomal protein L5 OS=Rickettsia prowazekii (strain Madrid E) GN=rplE PE=3 SV=1 137 302 4.0E-23
sp|O21252|RM05_RECAM 60S ribosomal protein L5, mitochondrial OS=Reclinomonas americana GN=RPL5 PE=3 SV=1 146 301 4.0E-23
sp|A4VHP2|RL5_PSEU5 50S ribosomal protein L5 OS=Pseudomonas stutzeri (strain A1501) GN=rplE PE=3 SV=1 135 301 4.0E-23
sp|Q46IS1|RL5_PROMT 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain NATL2A) GN=rplE PE=3 SV=1 145 304 4.0E-23
sp|A6W380|RL5_MARMS 50S ribosomal protein L5 OS=Marinomonas sp. (strain MWYL1) GN=rplE PE=3 SV=1 145 301 4.0E-23
sp|P10136|RL5_MYCCT 50S ribosomal protein L5 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplE PE=3 SV=2 122 301 5.0E-23
sp|P33098|RL5_MICLU 50S ribosomal protein L5 OS=Micrococcus luteus GN=rplE PE=3 SV=1 145 301 5.0E-23
sp|Q8ETX1|RL5_OCEIH 50S ribosomal protein L5 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplE PE=3 SV=1 145 301 5.0E-23
sp|B4RT40|RL5_ALTMD 50S ribosomal protein L5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplE PE=3 SV=1 145 301 5.0E-23
sp|Q8XV24|RL5_RALSO 50S ribosomal protein L5 OS=Ralstonia solanacearum (strain GMI1000) GN=rplE PE=3 SV=1 145 301 5.0E-23
sp|Q1RHN3|RL5_RICBR 50S ribosomal protein L5 OS=Rickettsia bellii (strain RML369-C) GN=rplE PE=3 SV=1 137 302 6.0E-23
sp|A8GVC6|RL5_RICB8 50S ribosomal protein L5 OS=Rickettsia bellii (strain OSU 85-389) GN=rplE PE=3 SV=1 137 302 6.0E-23
sp|B8D837|RL5_BUCAT 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplE PE=3 SV=1 130 301 6.0E-23
sp|P57579|RL5_BUCAI 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplE PE=3 SV=1 130 301 6.0E-23
sp|B8D9T5|RL5_BUCA5 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplE PE=3 SV=1 130 301 6.0E-23
sp|Q8UE30|RL5_AGRFC 50S ribosomal protein L5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplE PE=3 SV=1 146 301 6.0E-23
sp|Q0VSJ1|RL5_ALCBS 50S ribosomal protein L5 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplE PE=3 SV=1 135 301 6.0E-23
sp|A8GPD8|RL5_RICAH 50S ribosomal protein L5 OS=Rickettsia akari (strain Hartford) GN=rplE PE=3 SV=1 137 302 6.0E-23
sp|A6GZ87|RL5_FLAPJ 50S ribosomal protein L5 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rplE PE=3 SV=1 119 301 7.0E-23
sp|B3R7F6|RL5_CUPTR 50S ribosomal protein L5 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplE PE=3 SV=1 145 301 7.0E-23
sp|Q0K631|RL5_CUPNH 50S ribosomal protein L5 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplE PE=3 SV=1 145 301 7.0E-23
sp|Q12G91|RL5_POLSJ 50S ribosomal protein L5 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rplE PE=3 SV=1 145 301 7.0E-23
sp|Q0AII4|RL5_NITEC 50S ribosomal protein L5 OS=Nitrosomonas eutropha (strain C91) GN=rplE PE=3 SV=1 142 301 7.0E-23
sp|A4XZ78|RL5_PSEMY 50S ribosomal protein L5 OS=Pseudomonas mendocina (strain ymp) GN=rplE PE=3 SV=1 145 301 7.0E-23
sp|B2G8W6|RL5_LACRJ 50S ribosomal protein L5 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplE PE=3 SV=1 147 301 7.0E-23
sp|A5VLJ3|RL5_LACRD 50S ribosomal protein L5 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplE PE=3 SV=1 147 301 7.0E-23
sp|Q46WF6|RL5_CUPPJ 50S ribosomal protein L5 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplE PE=3 SV=1 145 301 7.0E-23
sp|A1JS20|RL5_YERE8 50S ribosomal protein L5 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplE PE=3 SV=1 145 301 8.0E-23
sp|A4SCS1|RL5_CHLPM 50S ribosomal protein L5 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rplE PE=3 SV=1 145 306 8.0E-23
sp|O24701|RL5_SYNP6 50S ribosomal protein L5 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplE PE=3 SV=1 134 301 8.0E-23
sp|Q31L19|RL5_SYNE7 50S ribosomal protein L5 OS=Synechococcus elongatus (strain PCC 7942) GN=rplE PE=3 SV=1 134 301 8.0E-23
sp|Q38US4|RL5_LACSS 50S ribosomal protein L5 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplE PE=3 SV=1 145 301 8.0E-23
sp|A1KB15|RL5_AZOSB 50S ribosomal protein L5 OS=Azoarcus sp. (strain BH72) GN=rplE PE=3 SV=1 145 301 9.0E-23
sp|Q7V9X4|RL5_PROMA 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplE PE=3 SV=1 135 301 9.0E-23
sp|Q47J91|RL5_DECAR 50S ribosomal protein L5 OS=Dechloromonas aromatica (strain RCB) GN=rplE PE=3 SV=1 145 301 9.0E-23
sp|B6JEX7|RL5_OLICO 50S ribosomal protein L5 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|C6DG62|RL5_PECCP 50S ribosomal protein L5 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplE PE=3 SV=1 137 301 1.0E-22
sp|Q057B6|RL5_BUCCC 50S ribosomal protein L5 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rplE PE=3 SV=1 130 301 1.0E-22
sp|Q6AD07|RL5_LEIXX 50S ribosomal protein L5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|B1X4Z6|RK5_PAUCH 50S ribosomal protein L5, organellar chromatophore OS=Paulinella chromatophora GN=rpl5 PE=3 SV=1 140 301 1.0E-22
sp|A1QZS6|RL5_BORT9 50S ribosomal protein L5 OS=Borrelia turicatae (strain 91E135) GN=rplE PE=3 SV=1 147 301 1.0E-22
sp|B2UEK7|RL5_RALPJ 50S ribosomal protein L5 OS=Ralstonia pickettii (strain 12J) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|Q8NSZ2|RL5_CORGL 50S ribosomal protein L5 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|A4QBJ6|RL5_CORGB 50S ribosomal protein L5 OS=Corynebacterium glutamicum (strain R) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|A0LIK2|RL5_SYNFM 50S ribosomal protein L5 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|B4SBV9|RL5_PELPB 50S ribosomal protein L5 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rplE PE=3 SV=1 146 306 1.0E-22
sp|Q3K600|RL5_PSEPF 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplE PE=3 SV=1 135 301 1.0E-22
sp|Q4K545|RL5_PSEF5 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplE PE=3 SV=1 135 301 1.0E-22
sp|A4SUX3|RL5_POLSQ 50S ribosomal protein L5 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|Q5F5T9|RL5_NEIG1 50S ribosomal protein L5 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|Q68W90|RL5_RICTY 50S ribosomal protein L5 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplE PE=3 SV=1 137 302 1.0E-22
sp|C0QW08|RL5_BRAHW 50S ribosomal protein L5 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rplE PE=3 SV=1 146 301 1.0E-22
sp|Q4ZMQ6|RL5_PSEU2 50S ribosomal protein L5 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplE PE=3 SV=1 135 301 1.0E-22
sp|Q889V9|RL5_PSESM 50S ribosomal protein L5 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplE PE=3 SV=1 135 301 1.0E-22
sp|Q48D48|RL5_PSE14 50S ribosomal protein L5 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplE PE=3 SV=1 135 301 1.0E-22
sp|A1KRI5|RL5_NEIMF 50S ribosomal protein L5 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|Q9K1I4|RL5_NEIMB 50S ribosomal protein L5 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|A9M3V4|RL5_NEIM0 50S ribosomal protein L5 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|Q3AW81|RL5_SYNS9 50S ribosomal protein L5 OS=Synechococcus sp. (strain CC9902) GN=rplE PE=3 SV=1 143 301 1.0E-22
sp|Q3A6N5|RL5_PELCD 50S ribosomal protein L5 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rplE PE=3 SV=1 145 301 1.0E-22
sp|Q7MYG3|RL5_PHOLL 50S ribosomal protein L5 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|C3K2W4|RL5_PSEFS 50S ribosomal protein L5 OS=Pseudomonas fluorescens (strain SBW25) GN=rplE PE=3 SV=1 135 301 2.0E-22
sp|A0L5Y5|RL5_MAGMM 50S ribosomal protein L5 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplE PE=3 SV=1 145 304 2.0E-22
sp|Q3B6F0|RL5_CHLL7 50S ribosomal protein L5 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplE PE=3 SV=1 145 304 2.0E-22
sp|Q2LQA8|RL5_SYNAS 50S ribosomal protein L5 OS=Syntrophus aciditrophicus (strain SB) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|Q83FZ8|RL5_TROWT 50S ribosomal protein L5 OS=Tropheryma whipplei (strain Twist) GN=rplE PE=3 SV=1 123 301 2.0E-22
sp|Q83I66|RL5_TROW8 50S ribosomal protein L5 OS=Tropheryma whipplei (strain TW08/27) GN=rplE PE=3 SV=1 123 301 2.0E-22
sp|Q9ZI40|RL5_AQUPY 50S ribosomal protein L5 OS=Aquifex pyrophilus GN=rplE PE=3 SV=2 145 301 2.0E-22
sp|A0M586|RL5_GRAFK 50S ribosomal protein L5 OS=Gramella forsetii (strain KT0803) GN=rplE PE=3 SV=1 137 301 2.0E-22
sp|C4LL24|RL5_CORK4 50S ribosomal protein L5 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rplE PE=3 SV=1 123 301 2.0E-22
sp|A9ADK5|RL5_BURM1 50S ribosomal protein L5 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|Q7VTB9|RL5_BORPE 50S ribosomal protein L5 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|Q7W2E3|RL5_BORPA 50S ribosomal protein L5 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|Q7WRB1|RL5_BORBR 50S ribosomal protein L5 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|A5GIT3|RL5_SYNPW 50S ribosomal protein L5 OS=Synechococcus sp. (strain WH7803) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|Q67JV5|RL5_SYMTH 50S ribosomal protein L5 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rplE PE=3 SV=1 135 301 2.0E-22
sp|A8LC44|RL5_FRASN 50S ribosomal protein L5 OS=Frankia sp. (strain EAN1pec) GN=rplE PE=3 SV=1 123 301 2.0E-22
sp|Q9JX13|RL5_NEIMA 50S ribosomal protein L5 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|B8E1E5|RL5_DICTD 50S ribosomal protein L5 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplE PE=3 SV=1 146 301 2.0E-22
sp|Q7V533|RL5_PROMM 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplE PE=3 SV=1 135 301 2.0E-22
sp|Q6F1Y2|RL5_MESFL 50S ribosomal protein L5 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|P47409|RL5_MYCGE 50S ribosomal protein L5 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rplE PE=3 SV=1 130 301 2.0E-22
sp|Q5WZK0|RL5_LEGPL 50S ribosomal protein L5 OS=Legionella pneumophila (strain Lens) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|A5IHQ2|RL5_LEGPC 50S ribosomal protein L5 OS=Legionella pneumophila (strain Corby) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|Q5X847|RL5_LEGPA 50S ribosomal protein L5 OS=Legionella pneumophila (strain Paris) GN=rplE PE=3 SV=1 145 301 2.0E-22
sp|A7HM40|RL5_FERNB 50S ribosomal protein L5 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rplE PE=3 SV=1 134 301 2.0E-22
sp|A6LLM5|RL5_THEM4 50S ribosomal protein L5 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplE PE=3 SV=1 142 301 3.0E-22
sp|Q5ZYN1|RL5_LEGPH 50S ribosomal protein L5 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplE PE=3 SV=1 145 301 3.0E-22
sp|A2CC40|RL5_PROM3 50S ribosomal protein L5 OS=Prochlorococcus marinus (strain MIT 9303) GN=rplE PE=3 SV=1 135 301 3.0E-22
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3662
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2696 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3531
Ophiocordyceps camponoti-floridani Ophcf2|00629
Ophiocordyceps camponoti-rufipedis Ophun1|7023
Ophiocordyceps kimflemingae Ophio5|5181
Ophiocordyceps subramaniannii Hirsu2|7076

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2696
MESTPTFTTPQPDQKTVEKFLSRRTNEEQLKLPGTRYQYHPPKYNRGSLHPIQSPPRSDPIARDFLPGPFNFPRL
RDTYESTIAPDLLTLTYKHIPPGSTPPHSEKGVLRTWDDSSPYYLNRPKREPRGKSSRLPLLEREITFNHIPKLW
GISVAMHTPEAARDKEHIHVARAIMQAITGTYPRVTTIKTNVASWKARAGAMGGLKTSLTGAKAYEFFDKLVTLV
LPKIKDWPGVDQKTGDGSGNVAIGMRPSWMAYFPELEYNFDMYPTKLIPGCYIFIKTTATSDRQGKLLLQSLGLP
FYYKLNHHH*
Coding >OphauG2|2696
ATGGAATCCACACCAACTTTTACCACCCCCCAGCCAGACCAGAAAACAGTCGAGAAATTCCTGTCTAGAAGAACA
AACGAGGAACAATTGAAGCTCCCCGGAACTCGCTATCAGTACCATCCTCCAAAGTATAACCGCGGCTCATTGCAC
CCCATACAGTCGCCACCTCGCTCAGATCCGATCGCTCGAGACTTTTTGCCCGGACCCTTCAACTTTCCCCGGCTC
AGGGACACGTACGAGTCGACCATTGCGCCAGATCTCTTGACTCTCACTTACAAACATATACCCCCCGGGTCAACG
CCACCCCATTCAGAAAAGGGCGTACTTCGAACCTGGGATGACTCGTCTCCATACTACCTGAACCGGCCGAAGCGA
GAGCCTCGAGGCAAATCCTCAAGACTTCCTTTGCTGGAGCGCGAAATCACCTTCAACCACATCCCCAAGCTCTGG
GGAATCTCCGTGGCCATGCACACTCCCGAGGCCGCACGCGACAAAGAGCATATACACGTTGCTCGTGCTATCATG
CAGGCCATTACTGGCACCTATCCCCGTGTGACGACAATCAAAACCAATGTGGCGAGTTGGAAGGCCAGGGCTGGC
GCCATGGGGGGCCTCAAAACGTCGCTGACCGGCGCCAAAGCGTATGAATTCTTTGACAAGCTCGTGACTCTGGTG
CTTCCCAAGATCAAAGACTGGCCTGGCGTCGACCAGAAAACCGGGGATGGCTCGGGCAACGTGGCTATTGGAATG
AGGCCATCATGGATGGCATATTTCCCAGAGCTCGAGTACAACTTTGACATGTATCCTACAAAGTTGATACCTGGC
TGTTACATCTTTATCAAAACCACCGCCACATCTGACAGACAAGGCAAGCTGCTTCTACAGTCGCTGGGATTGCCT
TTTTACTACAAGCTCAACCATCACCACTGA
Transcript >OphauG2|2696
ATGGAATCCACACCAACTTTTACCACCCCCCAGCCAGACCAGAAAACAGTCGAGAAATTCCTGTCTAGAAGAACA
AACGAGGAACAATTGAAGCTCCCCGGAACTCGCTATCAGTACCATCCTCCAAAGTATAACCGCGGCTCATTGCAC
CCCATACAGTCGCCACCTCGCTCAGATCCGATCGCTCGAGACTTTTTGCCCGGACCCTTCAACTTTCCCCGGCTC
AGGGACACGTACGAGTCGACCATTGCGCCAGATCTCTTGACTCTCACTTACAAACATATACCCCCCGGGTCAACG
CCACCCCATTCAGAAAAGGGCGTACTTCGAACCTGGGATGACTCGTCTCCATACTACCTGAACCGGCCGAAGCGA
GAGCCTCGAGGCAAATCCTCAAGACTTCCTTTGCTGGAGCGCGAAATCACCTTCAACCACATCCCCAAGCTCTGG
GGAATCTCCGTGGCCATGCACACTCCCGAGGCCGCACGCGACAAAGAGCATATACACGTTGCTCGTGCTATCATG
CAGGCCATTACTGGCACCTATCCCCGTGTGACGACAATCAAAACCAATGTGGCGAGTTGGAAGGCCAGGGCTGGC
GCCATGGGGGGCCTCAAAACGTCGCTGACCGGCGCCAAAGCGTATGAATTCTTTGACAAGCTCGTGACTCTGGTG
CTTCCCAAGATCAAAGACTGGCCTGGCGTCGACCAGAAAACCGGGGATGGCTCGGGCAACGTGGCTATTGGAATG
AGGCCATCATGGATGGCATATTTCCCAGAGCTCGAGTACAACTTTGACATGTATCCTACAAAGTTGATACCTGGC
TGTTACATCTTTATCAAAACCACCGCCACATCTGACAGACAAGGCAAGCTGCTTCTACAGTCGCTGGGATTGCCT
TTTTACTACAAGCTCAACCATCACCACTGA
Gene >OphauG2|2696
ATGGAATCCACACCAACTTTTACCACCCCCCAGCCAGACCAGAAAACAGTCGAGAAATTCCTGTCTAGAAGAACA
AACGAGGAACAATTGAAGCTCCCCGGAACTCGGTTGGTACCCCATGGTCTAAACACAGCGCCACAATGTGCTGAC
TAGAGCCAGCTATCAGTACCATCCTCCAAAGTATAACCGCGGCTCATTGCACCCCATACAGTCGCCACCTCGCTC
AGATCCGATCGCTCGAGACTTTTTGCCCGGACCCTTCAACTTTCCCCGGCTCAGGGACACGTACGAGTCGACCAT
TGCGCCAGATCTCTTGACTCTCACTTACAAACATATACCCCCCGGGTCAACGCCACCCCATTCAGAAAAGGGCGT
ACTTCGAACCTGGGATGACTCGTCTCCATACTACCTGAACCGGCCGAAGCGAGAGCCTCGAGGCAAATCCTCAAG
ACTTCCTTTGCTGGAGCGCGAAATCACCTTCAACCACATCCCCAAGCTCTGGGGAATCTCCGTGGCCATGCACAC
TCCCGAGGCCGCACGCGACAAAGAGCATATACACGTTGCTCGTGCTATCATGCAGGCCATTACTGGCACCTATCC
CCGTGTGACGACAATCAAAACCAATGTGGCGAGTTGGAAGGCCAGGGCTGGCGCCATGGGGGGCCTCAAAACGTC
GCTGACCGGCGCCAAAGCGTATGAATTCTTTGACAAGCTCGTGACTCTGGTGCTTCCCAAGATCAAAGACTGGCC
TGGCGTCGACCAGAAAACCGGGGATGGCTCGGGCAACGTGGCTATTGGAATGAGGCCATCATGGATGGCATATTT
CCCAGAGCTCGAGTACAACTTTGACGTGAGCCAATCAGCCTCTTTAAGACGGCTAATTCCAGTGGTGGCTCGTGG
CTGACTTGCGATTTTTTTTTCATTCTAGATGTATCCTACAAAGTTGATACCTGGCTGTTACATCTTTATCAAAAC
CACCGCCACATCTGACAGACAAGGCAAGCTGCTTCTACAGTCGCTGGGATTGCCTTTTTACTACAAGCTCAACCA
TCACCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail