Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|269
Gene name
LocationContig_1056:3511..6220
Strand-
Gene length (bp)2709
Transcript length (bp)2445
Coding sequence length (bp)2445
Protein length (aa) 815

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00648 Peptidase_C2 Calpain family cysteine protease 7.2E-22 121 357
PF01067 Calpain_III Calpain large subunit, domain III 3.0E-07 555 663

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y6Z8|PALB_ASPOR Calpain-like protease palB/RIM13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palB PE=3 SV=1 18 813 0.0E+00
sp|Q7RZP7|PALB_NEUCR Calpain-like protease palB/cpr-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr-8 PE=3 SV=3 1 813 0.0E+00
sp|Q00204|PALB_EMENI Calpain-like protease palB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palB PE=3 SV=2 1 813 1.0E-177
sp|Q9R1S8|CAN7_MOUSE Calpain-7 OS=Mus musculus GN=Capn7 PE=2 SV=1 15 674 3.0E-77
sp|Q9Y6W3|CAN7_HUMAN Calpain-7 OS=Homo sapiens GN=CAPN7 PE=1 SV=1 63 674 4.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y6Z8|PALB_ASPOR Calpain-like protease palB/RIM13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palB PE=3 SV=1 18 813 0.0E+00
sp|Q7RZP7|PALB_NEUCR Calpain-like protease palB/cpr-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpr-8 PE=3 SV=3 1 813 0.0E+00
sp|Q00204|PALB_EMENI Calpain-like protease palB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palB PE=3 SV=2 1 813 1.0E-177
sp|Q9R1S8|CAN7_MOUSE Calpain-7 OS=Mus musculus GN=Capn7 PE=2 SV=1 15 674 3.0E-77
sp|Q9Y6W3|CAN7_HUMAN Calpain-7 OS=Homo sapiens GN=CAPN7 PE=1 SV=1 63 674 4.0E-77
sp|A0FKG7|CAN7_PIG Calpain-7 OS=Sus scrofa GN=CAPN7 PE=2 SV=1 15 674 1.0E-74
sp|P0CQ06|PALB_CRYNJ Calpain-like protease palB/RIM13 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RIM13 PE=3 SV=1 18 680 2.0E-60
sp|P0CQ07|PALB_CRYNB Calpain-like protease palB/RIM13 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RIM13 PE=3 SV=1 18 680 2.0E-60
sp|Q9HFC8|PALB_YARLI Calpain-like protease palB/RIM13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM13 PE=3 SV=1 89 682 3.0E-57
sp|Q6BH66|PALB_DEBHA Calpain-like protease palB/RIM13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G20988g PE=3 SV=2 156 674 7.0E-48
sp|Q5AK25|PALB_CANAL Calpain-like protease palB/RIM13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM13 PE=3 SV=1 94 675 4.0E-41
sp|Q8RVL2|DEK1_ARATH Calpain-type cysteine protease DEK1 OS=Arabidopsis thaliana GN=DEK1 PE=1 SV=1 29 541 2.0E-13
sp|Q8RVL1|DEK1_MAIZE Calpain-type cysteine protease DEK1 OS=Zea mays GN=DEK1 PE=1 SV=2 100 541 6.0E-11
sp|Q03792|RIM13_YEAST Calpain-like protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM13 PE=1 SV=1 164 673 1.0E-10
sp|Q6ZFZ4|DEK1_ORYSJ Calpain-type cysteine protease ADL1 OS=Oryza sativa subsp. japonica GN=ADL1 PE=1 SV=1 100 541 2.0E-10
sp|P27398|CAND_DROME Calpain-D OS=Drosophila melanogaster GN=sol PE=1 SV=2 154 391 2.0E-09
sp|O75808|CAN15_HUMAN Calpain-15 OS=Homo sapiens GN=CAPN15 PE=1 SV=1 127 391 4.0E-09
sp|Q6MZZ7|CAN13_HUMAN Calpain-13 OS=Homo sapiens GN=CAPN13 PE=1 SV=2 127 393 2.0E-08
sp|Q9JLG8|CAN15_MOUSE Calpain-15 OS=Mus musculus GN=Capn15 PE=1 SV=1 154 391 7.0E-08
sp|Q6CKY3|PALB_KLULA Calpain-like protease palB/RIM13 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RIM13 PE=3 SV=1 32 407 1.0E-07
sp|O15484|CAN5_HUMAN Calpain-5 OS=Homo sapiens GN=CAPN5 PE=1 SV=2 156 426 2.0E-07
sp|Q8N7X0|ADGB_HUMAN Androglobin OS=Homo sapiens GN=ADGB PE=2 SV=3 95 301 2.0E-07
sp|O14815|CAN9_HUMAN Calpain-9 OS=Homo sapiens GN=CAPN9 PE=1 SV=1 127 391 2.0E-07
sp|Q9UMQ6|CAN11_HUMAN Calpain-11 OS=Homo sapiens GN=CAPN11 PE=2 SV=2 127 434 2.0E-07
sp|Q6FJ28|PALB_CANGA Calpain-like protease palB/RIM13 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RIM13 PE=3 SV=1 163 445 4.0E-07
sp|A8MX76|CAN14_HUMAN Calpain-14 OS=Homo sapiens GN=CAPN14 PE=2 SV=2 127 429 5.0E-07
sp|O35920|CAN9_RAT Calpain-9 OS=Rattus norvegicus GN=Capn9 PE=2 SV=2 127 391 5.0E-07
sp|Q5BK10|CAN13_RAT Calpain-13 OS=Rattus norvegicus GN=Capn13 PE=2 SV=1 127 393 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004198 calcium-dependent cysteine-type endopeptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0004197 cysteine-type endopeptidase activity No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0043170 macromolecule metabolic process No
GO:0008234 cysteine-type peptidase activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4967
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|269 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4062
Ophiocordyceps camponoti-floridani Ophcf2|04254
Ophiocordyceps camponoti-rufipedis Ophun1|4717
Ophiocordyceps kimflemingae Ophio5|8235
Ophiocordyceps subramaniannii Hirsu2|2039

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|269
MEARAQVVEASLAHANGRDALELAIQAAELYMAAARDTLSKSEASRLRRKCRELILYAEQLKAQTQTPSDHQMLI
LQRASHLHGNHFPPWNSDPPEAEFELPPGADLYTDQATFTLSPTQVDNFAGWTRPTDLFGLDSDRHSANDDLMMK
LTGPCDLVQDITTDCSVVASLSAAAKVLLGRHAVLSTIIFPFDCLKGRPRLSTAGKYIIRMNFNGCSRRVVIDDR
LPASRSDRALFVIDRRHPYLLWPALLEKAYLKVRGGYDFPGSNSGTDLWVLMGWIPEQIFLQREDFDVNETWERI
KAAHTSHDVVVTLGTGCISAQEEQLMGLIGEHDYAVEDIDSTHDGARKMLIKNPWRNAPLMAARGNRDSHGDCHN
TAWMSLEDIAQHFESMYLNWNPSLFSYRLDRHFIWEMPSARLATSLVKNPQFTLCLPAGGSIWVLVSRHFVDAEL
DIARNRRDSMAAVARQLGFMSILVFDSQGRRVQISGRETYRGPYVDSPQTLARLKLSPGKRYTVVVDQHEFPLAS
YTFTMSLFSCARFQLDEAEEPMSHFQELLGSWTRRTAGGNPSCQTFYQNPQYKLSVSNTGPLSILIATDHEDVHV
HVDLVWAQGERVTTVRVKDLISSSGEYRRGCAVAAVSMLEPGVYTIVCSTFEVGQTAGFALRIASMAPVSVSSVP
ADGAGRLRTPLAVVRLAGEEKRRARLAASWLTRASVSINSVLSPGTEETAKSVPALLMRISIVQGWGPERATVAI
SGDGEFREPLRVLRTPEFDIDPAQIHDQDMWLVMECIGVHHTPYNVHSELLSDSPVQIGPWMVM*
Coding >OphauG2|269
ATGGAAGCAAGAGCGCAAGTAGTCGAGGCTTCACTGGCCCATGCTAATGGCAGAGACGCTCTTGAACTTGCCATA
CAAGCCGCTGAGCTCTATATGGCAGCCGCTCGCGACACCTTGTCGAAATCTGAGGCCTCTCGCCTCAGGCGCAAG
TGTCGGGAGCTTATACTTTACGCAGAACAACTCAAGGCTCAGACCCAGACGCCATCAGATCATCAGATGCTCATT
TTGCAGCGTGCATCACACCTTCATGGAAACCACTTCCCCCCTTGGAACTCTGATCCCCCCGAAGCCGAGTTTGAG
CTGCCTCCAGGCGCCGACCTCTATACAGATCAGGCTACTTTTACACTTTCTCCAACCCAAGTGGACAATTTTGCC
GGCTGGACCAGACCTACCGACCTTTTTGGACTCGATTCTGATCGACATAGCGCTAATGATGACCTCATGATGAAA
CTCACTGGCCCCTGCGATCTCGTTCAAGACATCACCACGGATTGCTCAGTCGTTGCAAGCCTATCTGCAGCAGCA
AAGGTGCTACTCGGGAGACATGCTGTTCTCTCGACTATTATTTTCCCGTTTGACTGCCTTAAAGGACGACCAAGA
CTGTCAACTGCAGGGAAATATATTATACGAATGAACTTTAATGGTTGCTCTAGGCGCGTTGTTATCGATGACCGA
CTGCCTGCATCGCGATCAGATCGTGCTCTATTCGTCATTGATAGGCGCCATCCTTACTTATTGTGGCCTGCTCTT
CTCGAAAAGGCTTATCTCAAAGTACGAGGCGGCTATGATTTCCCAGGCAGCAACTCTGGGACCGATCTATGGGTT
TTGATGGGGTGGATTCCTGAACAGATATTTTTGCAACGCGAAGACTTTGACGTCAATGAGACTTGGGAAAGAATC
AAAGCAGCTCATACCTCCCATGATGTTGTCGTCACGCTAGGAACTGGGTGCATCTCTGCCCAAGAAGAACAACTC
ATGGGTCTTATTGGCGAACACGACTACGCAGTTGAAGACATTGACTCGACACATGATGGGGCGCGCAAAATGCTC
ATAAAAAATCCTTGGCGCAATGCTCCTCTAATGGCTGCAAGGGGAAACCGTGATTCTCATGGCGATTGTCACAAC
ACTGCCTGGATGTCGCTCGAAGATATTGCCCAACATTTTGAGTCGATGTATCTTAACTGGAACCCAAGCCTCTTC
TCCTACCGTCTGGACCGCCACTTCATCTGGGAAATGCCATCGGCTCGTTTGGCTACTTCCCTTGTTAAAAACCCC
CAGTTTACACTCTGCCTACCAGCTGGCGGCTCCATCTGGGTTCTTGTAAGCCGTCACTTTGTCGATGCCGAACTC
GACATCGCCCGCAATAGACGAGACTCCATGGCAGCTGTCGCGCGCCAACTCGGCTTCATGAGTATTCTAGTCTTT
GATTCTCAAGGGCGTAGAGTACAAATCAGCGGTAGAGAGACTTACCGTGGACCCTATGTCGACTCTCCTCAGACA
CTTGCGCGCCTCAAACTGAGCCCTGGCAAGCGATACACTGTAGTAGTTGACCAACACGAATTTCCACTAGCCAGT
TATACCTTCACCATGTCGCTCTTCTCTTGCGCGCGATTTCAATTAGATGAAGCTGAGGAGCCAATGTCTCACTTC
CAAGAGCTGCTAGGTTCATGGACTCGACGCACAGCTGGAGGAAACCCGTCATGCCAAACATTCTACCAGAATCCT
CAGTATAAGCTATCTGTCAGCAATACCGGTCCTCTATCCATTCTCATAGCCACGGACCATGAAGATGTCCATGTA
CATGTTGACCTTGTCTGGGCGCAGGGAGAGCGGGTAACGACCGTGCGCGTCAAAGATCTAATCTCTTCATCGGGT
GAATACCGTCGAGGGTGCGCAGTAGCCGCCGTATCCATGCTTGAGCCTGGCGTCTACACAATAGTGTGCTCAACG
TTTGAGGTTGGCCAAACGGCCGGTTTTGCGCTGAGAATCGCGTCCATGGCGCCAGTCTCAGTCAGTTCTGTCCCA
GCTGATGGCGCAGGCAGGCTTCGGACACCGCTCGCCGTTGTTCGTCTGGCGGGAGAAGAAAAAAGACGAGCACGA
CTGGCTGCGTCGTGGCTCACGCGTGCCAGTGTATCAATCAATAGTGTTCTGTCGCCGGGCACAGAAGAAACTGCA
AAATCTGTTCCCGCTCTTCTCATGCGCATCTCCATCGTACAAGGTTGGGGTCCCGAACGAGCCACAGTTGCAATC
TCGGGCGATGGTGAATTCCGAGAACCCCTGAGAGTCCTACGCACCCCCGAATTCGACATAGACCCAGCACAAATT
CATGACCAAGATATGTGGCTTGTCATGGAGTGCATTGGAGTGCACCATACGCCATACAACGTACACAGCGAGCTT
CTAAGTGACTCGCCTGTTCAAATTGGGCCTTGGATGGTGATGTGA
Transcript >OphauG2|269
ATGGAAGCAAGAGCGCAAGTAGTCGAGGCTTCACTGGCCCATGCTAATGGCAGAGACGCTCTTGAACTTGCCATA
CAAGCCGCTGAGCTCTATATGGCAGCCGCTCGCGACACCTTGTCGAAATCTGAGGCCTCTCGCCTCAGGCGCAAG
TGTCGGGAGCTTATACTTTACGCAGAACAACTCAAGGCTCAGACCCAGACGCCATCAGATCATCAGATGCTCATT
TTGCAGCGTGCATCACACCTTCATGGAAACCACTTCCCCCCTTGGAACTCTGATCCCCCCGAAGCCGAGTTTGAG
CTGCCTCCAGGCGCCGACCTCTATACAGATCAGGCTACTTTTACACTTTCTCCAACCCAAGTGGACAATTTTGCC
GGCTGGACCAGACCTACCGACCTTTTTGGACTCGATTCTGATCGACATAGCGCTAATGATGACCTCATGATGAAA
CTCACTGGCCCCTGCGATCTCGTTCAAGACATCACCACGGATTGCTCAGTCGTTGCAAGCCTATCTGCAGCAGCA
AAGGTGCTACTCGGGAGACATGCTGTTCTCTCGACTATTATTTTCCCGTTTGACTGCCTTAAAGGACGACCAAGA
CTGTCAACTGCAGGGAAATATATTATACGAATGAACTTTAATGGTTGCTCTAGGCGCGTTGTTATCGATGACCGA
CTGCCTGCATCGCGATCAGATCGTGCTCTATTCGTCATTGATAGGCGCCATCCTTACTTATTGTGGCCTGCTCTT
CTCGAAAAGGCTTATCTCAAAGTACGAGGCGGCTATGATTTCCCAGGCAGCAACTCTGGGACCGATCTATGGGTT
TTGATGGGGTGGATTCCTGAACAGATATTTTTGCAACGCGAAGACTTTGACGTCAATGAGACTTGGGAAAGAATC
AAAGCAGCTCATACCTCCCATGATGTTGTCGTCACGCTAGGAACTGGGTGCATCTCTGCCCAAGAAGAACAACTC
ATGGGTCTTATTGGCGAACACGACTACGCAGTTGAAGACATTGACTCGACACATGATGGGGCGCGCAAAATGCTC
ATAAAAAATCCTTGGCGCAATGCTCCTCTAATGGCTGCAAGGGGAAACCGTGATTCTCATGGCGATTGTCACAAC
ACTGCCTGGATGTCGCTCGAAGATATTGCCCAACATTTTGAGTCGATGTATCTTAACTGGAACCCAAGCCTCTTC
TCCTACCGTCTGGACCGCCACTTCATCTGGGAAATGCCATCGGCTCGTTTGGCTACTTCCCTTGTTAAAAACCCC
CAGTTTACACTCTGCCTACCAGCTGGCGGCTCCATCTGGGTTCTTGTAAGCCGTCACTTTGTCGATGCCGAACTC
GACATCGCCCGCAATAGACGAGACTCCATGGCAGCTGTCGCGCGCCAACTCGGCTTCATGAGTATTCTAGTCTTT
GATTCTCAAGGGCGTAGAGTACAAATCAGCGGTAGAGAGACTTACCGTGGACCCTATGTCGACTCTCCTCAGACA
CTTGCGCGCCTCAAACTGAGCCCTGGCAAGCGATACACTGTAGTAGTTGACCAACACGAATTTCCACTAGCCAGT
TATACCTTCACCATGTCGCTCTTCTCTTGCGCGCGATTTCAATTAGATGAAGCTGAGGAGCCAATGTCTCACTTC
CAAGAGCTGCTAGGTTCATGGACTCGACGCACAGCTGGAGGAAACCCGTCATGCCAAACATTCTACCAGAATCCT
CAGTATAAGCTATCTGTCAGCAATACCGGTCCTCTATCCATTCTCATAGCCACGGACCATGAAGATGTCCATGTA
CATGTTGACCTTGTCTGGGCGCAGGGAGAGCGGGTAACGACCGTGCGCGTCAAAGATCTAATCTCTTCATCGGGT
GAATACCGTCGAGGGTGCGCAGTAGCCGCCGTATCCATGCTTGAGCCTGGCGTCTACACAATAGTGTGCTCAACG
TTTGAGGTTGGCCAAACGGCCGGTTTTGCGCTGAGAATCGCGTCCATGGCGCCAGTCTCAGTCAGTTCTGTCCCA
GCTGATGGCGCAGGCAGGCTTCGGACACCGCTCGCCGTTGTTCGTCTGGCGGGAGAAGAAAAAAGACGAGCACGA
CTGGCTGCGTCGTGGCTCACGCGTGCCAGTGTATCAATCAATAGTGTTCTGTCGCCGGGCACAGAAGAAACTGCA
AAATCTGTTCCCGCTCTTCTCATGCGCATCTCCATCGTACAAGGTTGGGGTCCCGAACGAGCCACAGTTGCAATC
TCGGGCGATGGTGAATTCCGAGAACCCCTGAGAGTCCTACGCACCCCCGAATTCGACATAGACCCAGCACAAATT
CATGACCAAGATATGTGGCTTGTCATGGAGTGCATTGGAGTGCACCATACGCCATACAACGTACACAGCGAGCTT
CTAAGTGACTCGCCTGTTCAAATTGGGCCTTGGATGGTGATGTGA
Gene >OphauG2|269
ATGGAAGCAAGAGCGCAAGTAGTCGAGGCTTCACTGGCCCATGCTAATGGCAGAGACGCTCTTGAACTTGCCATA
CAAGCCGCTGAGCTCTATATGGCAGCCGCTCGCGACACCTTGTCGAAATCTGAGGCCTCTCGCCTCAGGCGCAAG
TGTCGGGAGCTTATACTTTACGCAGAACAACTCAAGGCTCAGACCCAGACGCCATCAGATCATCAGATGCTCATT
TTGCAGCGTGCATCACACCTTCATGGAAACCACTTCCCCCCTTGGAACTCTGATCCCCCCGAAGCCGAGTTTGAG
CTGCCTCCAGGCGCCGACCTCTATACGTGAGCTTGTCGCAGTCCTCTCGGTCTCGGCCTCGGCCCTTCACTCACA
TGTATTACTCTGTCCCTCTTGGTAAAAGAGATCAGGCTACTTTTACACTTTCTCCAACCCAAGTGGACAATTTTG
CCGGCTGGACCAGACCTACCGACCTTTTTGGACTCGATTCTGATCGACATAGCGCTAATGATGACCTCATGATGA
AACTCACTGGCCCCTGCGATCTCGTTCAAGACATCACCACGGATTGCTCAGTCGTTGCAAGCCTATCTGCAGCAG
CAAAGGTGCTACTCGGGAGACATGCTGTACGATTTCATCTCTTGACTTGTCAACATGACCCATGCTCTAACTCAC
GACTATAAGGTTCTCTCGACTATTATTTTCCCGTTTGACTGCCTTAAAGGACGACCAAGACTGTCAACTGCAGGG
AAATATATTATACGAATGAACTTTAATGGTTGCTCTAGGCGCGTTGTTATCGATGACCGACTGCCTGCATCGCGA
TCAGATCGTGCTCTATTCGTCATTGATAGGCGCCATCCTTACTTATTGTGGCCTGCTCTTCTCGAAAAGGCTTAT
CTCAAAGTACGAGGCGGCTATGATTTCCCAGGCAGCAACTCTGGGACCGATCTATGGGTTTTGATGGGGTGGATT
CCTGAACAGATATTTTTGCAACGGTATTCTCATCACGAGTAAAAAAGCGCAACTATCTGCCTTGACTAATATTGC
ACGATAGCGAAGACTTTGACGTCAATGAGACTTGGGAAAGAATCAAAGCAGCTCATACCTCCCATGATGTTGTCG
TCACGCTAGGAACTGGGTGCATCTCTGCCCAAGAAGAACAACTCATGGGTCTTATTGGCGAACACGACTACGCAG
TTGAAGACATTGACTCGACACATGATGGGGCGCGCAAAATGCTCATAAAAAATCCTTGGCGCAATGCTCCTCTAA
TGGCTGCAAGGGGAAACCGTGATTCTCATGGCGATTGTCACAAGTAAGTCTCGGCCTTGTGAACCTCTCCATCGT
TTTGTCTCTAACCAAATCTACTTTTTTTCATTACCCAGCACTGCCTGGATGTCGCTCGAAGATATTGCCCAACAT
TTTGAGTCGATGTATCTTAACTGGAACCCAAGCCTCTTCTCCTACCGTCTGGACCGCCACTTCATCTGGGAAATG
CCATCGGCTCGTTTGGCTACTTCCCTTGTTAAAAACCCCCAGTTTACACTCTGCCTACCAGCTGGCGGCTCCATC
TGGGTTCTTGTAAGCCGTCACTTTGTCGATGCCGAACTCGACATCGCCCGCAATAGACGAGACTCCATGGCAGCT
GTCGCGCGCCAACTCGGCTTCATGAGTATTCTAGTCTTTGATTCTCAAGGGCGTAGAGTACAAATCAGCGGTAGA
GAGACTTACCGTGGACCCTATGTCGACTCTCCTCAGACACTTGCGCGCCTCAAACTGAGCCCTGGCAAGCGATAC
ACTGTAGTAGTTGACCAACACGAATTTCCACTAGCCAGTTATACCTTCACCATGTCGCTCTTCTCTTGCGCGCGA
TTTCAATTAGATGAAGCTGAGGAGCCAATGTCTCACTTCCAAGAGCTGCTAGGTTCATGGACTCGACGCACAGCT
GGAGGAAACCCGTCATGCCAAACATTCTACCAGAATCCTCAGTATAAGCTATCTGTCAGCAATACCGGTCCTCTA
TCCATTCTCATAGCCACGGACCATGAAGATGTCCATGTACATGTTGACCTTGTCTGGGCGCAGGGAGAGCGGGTA
ACGACCGTGCGCGTCAAAGATCTAATCTCTTCATCGGGTGAATACCGTCGAGGGTGCGCAGTAGCCGCCGTATCC
ATGCTTGAGCCTGGCGTCTACACAATAGTGTGCTCAACGTTTGAGGTTGGCCAAACGGCCGGTTTTGCGCTGAGA
ATCGCGTCCATGGCGCCAGTCTCAGTCAGTTCTGTCCCAGCTGATGGCGCAGGCAGGCTTCGGACACCGCTCGCC
GTTGTTCGTCTGGCGGGAGAAGAAAAAAGACGAGCACGACTGGCTGCGTCGTGGCTCACGCGTGCCAGTGTATCA
ATCAATAGTGTTCTGTCGCCGGGCACAGAAGAAACTGCAAAATCTGTTCCCGCTCTTCTCATGCGCATCTCCATC
GTACAAGGTTGGGGTCCCGAACGAGCCACAGTTGCAATCTCGGGCGATGGTGAATTCCGAGAACCCCTGAGAGTC
CTACGCACCCCCGAATTCGACATAGACCCAGCACAAATTCATGACCAAGATATGTGGCTTGTCATGGAGTGCATT
GGAGTGCACCATACGCCATACAACGTACACAGCGAGCTTCTAAGTGACTCGCCTGTTCAAATTGGGCCTTGGATG
GTGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail